KEGG   Clostridium botulinum E3: CLH_3241Help
Entry
CLH_3241          CDS       T00767                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLH_3241 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLH_3241 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLH_3241 (trpA)
Enzymes [BR:cbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLH_3241 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3502987..3503754)
Genome map
AA seq 255 aa AA seqDB search
MNNLENYLLKRIKENRKMEIICYLSNGYPTIEDSYRIAEEYVDAGCNMIEIDFPSRDPYL
ESEYIADRMAKSLEACDDYDKYMDSIVAVKKNLPNVKLLVLAYENTVEEIGVDKFINFCL
ENDFKDILLVGLRNEEIKNKIIENGLRVSCYVQYHLLPEEIEYAKKSNGFVYLQAKPNPG
MINPKYPELSDCVEHLRECGIDRPIYCGVGVHAPEDVKMVKEAGGDAAFVGSTILKLQTD
IPAMKDMIRKFKEQC
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaatttagagaattatttattaaagcgtataaaggagaatagaaagatggaaata
atttgttacttatcaaacggatacccaacaatagaagatagttatagaattgctgaagaa
tatgtagatgcaggttgtaatatgatagaaattgattttccttcaagagatccatattta
gaaagtgaatatatagcggatagaatggcaaaatcattagaagcatgtgatgattatgat
aaatatatggatagtattgtagcggtgaaaaagaatttacctaatgttaagttactagtt
ttagcttatgaaaatactgtagaagaaataggcgtagataaatttataaacttctgttta
gaaaatgattttaaagatattcttttagtaggtttaagaaatgaagaaataaaaaataaa
attatagaaaatgggttaagagtttcatgttatgtacaatatcacttattaccagaagaa
attgaatatgcaaaaaaatcaaatggatttgtatacttacaagcaaaaccaaatccagga
atgataaatcctaaatatcctgaattaagtgattgtgtagaacatttaagagaatgtggt
atagatcgtccaatatactgtggtgtaggagtacacgcaccagaagatgttaagatggta
aaagaagctggtggagatgcagcttttgttggaagtactattttaaaattacaaacagat
atacccgctatgaaagatatgattcgtaaatttaaagaacaatgttaa

DBGET integrated database retrieval system