KEGG   Clostridium botulinum E3: CLH_3329Help
Entry
CLH_3329          CDS       T00767                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cbt  Clostridium botulinum E3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CLH_3329
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CLH_3329
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CLH_3329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3601138..3601614)
Genome map
AA seq 158 aa AA seqDB search
MNFYDFSAKKINGREISMNEFKGKIILVVNTASKCGLTPQFKELEEIYKEYKKKGFEILG
FPCNQFAKQDSGNNKEINEFCQLNYGVSFNMFEKIDVNGKNAHPIYQYLKNETKGVLSKE
IKWNFTKFLIDVEGNVIKRYAPITSPLKIKDDIEKLLK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatgatttttcagcaaagaaaataaatggtagagaaataagcatgaacgaa
tttaagggaaaaataattttagttgtaaatactgcaagtaagtgtggattaacacctcaa
tttaaagagttagaagaaatatataaagaatataaaaaaaagggttttgaaattttagga
tttccttgtaaccaatttgctaaacaggattcagggaacaataaagaaataaatgaattt
tgtcaattaaactatggagttagttttaatatgtttgaaaaaatagacgtgaatggaaag
aatgctcatcctatatatcaatatttaaaaaatgaaactaaaggtgttttaagtaaagaa
ataaagtggaattttactaagtttttaatagatgttgaagggaatgtaataaaaagatat
gcacctataacaagtccattaaaaataaaagatgatattgaaaagttgttgaaataa

DBGET integrated database retrieval system