KEGG   Coxiella burnetii RSA 493: CBU_0143Help
Entry
CBU_0143          CDS       T00124                                 

Definition
hypothetical protein
Organism
cbu  Coxiella burnetii RSA 493
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(130815..130946)
Genome map
AA seq 43 aa AA seqDB search
MYHYPQVTAISILNFVIPRRRPGALLARCARCALGPRLRGNDD
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgtatcattatccacaagtcacagccatttccattttaaacttcgtgatcccgcgcagg
agaccaggcgcgcttttagcgcgctgcgcacggtgtgcgctgggtccccgcctgcgcggg
aatgacgattaa

DBGET integrated database retrieval system