KEGG   Coxiella burnetii RSA 493: CBU_0287Help
Entry
CBU_0287          CDS       T00124                                 

Gene name
folK-2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CBU_0287 (folK-2)
Enzymes [BR:cbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CBU_0287 (folK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256979..257539
Genome map
AA seq 186 aa AA seqDB search
MTIAYVGVGANLDNPLKQVQIAVSNLSTLPQTACLGYSSFYRSKPLGPTDQPDYINAVAA
VETTLSPQMLLKALQRLEEKQGRCRGGKRWGPRIIDLDILLYGDLALQSDELCLPHPGLF
VREFVLYPLAEVAEDLILPGGESILELKAKCPDRGIERIIKNPSSLLPFPFRGKGLEKEG
DTKALA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagcctatgttggcgtaggggcaaacctggataatccgctcaagcaagtgcaa
atcgcggtaagtaatttgtccacgttgccgcaaactgcttgtcttggctattccagcttt
tatcggagcaaaccgttgggcccgactgatcaaccggattacatcaacgccgtagcagcg
gttgaaactaccttgtccccccaaatgcttttgaaagcattgcaacgactcgaagaaaaa
caaggccggtgtcggggcgggaaacgatgggggccgcggattatcgatctcgatatttta
ttgtatggagatcttgcgcttcagagcgatgagctttgtcttccccatccgggacttttt
gtgcgggaatttgtgctttatccactggctgaagtcgcagaagacttgattttacccggc
ggcgagtctattttggaactgaaagcaaaatgccctgatcgaggcattgaacgaattata
aaaaacccctcttcactacttccttttccctttagggggaaagggttggagaaagagggt
gatacaaaggcgctagcatga

DBGET integrated database retrieval system