KEGG   Coxiella burnetii RSA 493: CBU_0513Help
Entry
CBU_0513          CDS       T00124                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00010  Glycolysis / Gluconeogenesis
cbu00030  Pentose phosphate pathway
cbu00051  Fructose and mannose metabolism
cbu00680  Methane metabolism
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
cbu01230  Biosynthesis of amino acids
Module
cbu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBU_0513
   00030 Pentose phosphate pathway
    CBU_0513
   00051 Fructose and mannose metabolism
    CBU_0513
  Energy metabolism
   00680 Methane metabolism
    CBU_0513
Enzymes [BR:cbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CBU_0513
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CBU_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-GeneID: 1208397
NCBI-ProteinID: NP_819545
UniProt: Q83E23
Position
453558..454706
Genome map
AA seq 382 aa AA seqDB search
MEITLSAIKADVGSIGGHTQPSIEMLQAVQQSLQKNIDSGLLIDGLVTFTGDDIAIICSH
QQGLNNEDVHVGFAWQAFLAATEVAKEQGNYGAGQDLLVDAPSGNVRGAGPGVAEIEFTL
NPKSNYRPAESFMIFAGDKCAPGAFNLPLYLVFCDPMHNGGILLNPKIHLGWVFTVIDMD
YKGEDEDRIIQLSVPERSWDVAALLQNPDRYAVESIRSRYKPEEQVVSVSATRLHNIAGK
YTGKDDPIAIIRSQGIFPAPEEIIEPYSTINQIISGDARGSHNMPQLPVPINTPVTGPYC
HPLISALGFSMNKQGKFAGRYVDFFAGSAWDYARYVSQRRAAEIRRQGFMGIAMAQEAEI
AYTGLVDTWKKLDDEFELRKNG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaccttaagcgctattaaagccgatgtgggcagtatcggcggtcacacccaa
cctagcattgaaatgctacaggctgttcagcaatcccttcaaaagaatatcgactccgga
ttattgatcgatggattggtaactttcactggcgatgatattgcgattatttgttcacat
caacagggtttaaataatgaagacgttcatgtcggttttgcgtggcaagcttttcttgca
gcaactgaagtggcgaaagagcaaggcaattacggcgctggccaggatttactcgtggat
gcgccttctggcaatgttcgaggcgctggacctggtgttgctgaaattgaatttaccctt
aatccaaaatccaattaccgtccggctgaatcctttatgatatttgcaggtgataagtgc
gcacccggcgcatttaatcttcctctttatttagttttttgtgatccgatgcataatggg
ggaattttattaaatccaaaaatacatttaggctgggtgtttacggtgattgatatggat
tacaaaggggaagacgaagatcgtattattcagctttctgttcccgaacgctcctgggac
gttgccgcgttgttgcaaaatcccgatcggtatgcggttgaatccattcgctcacgttat
aaacctgaagaacaagtggtttctgtttctgccacgcgattgcataacattgcaggaaaa
tacacaggcaaggatgatccaattgctattattcgcagtcaaggtatttttccggcacct
gaggaaattattgagccgtattcgactattaatcaaattatcagcggcgatgcgcgcggc
tctcataacatgccgcaattaccggttcctattaatacgcctgttactggaccgtattgt
catcccctaatttcggcacttggtttttccatgaataagcagggtaaatttgctggacgt
tatgtggatttttttgcgggttctgcttgggattacgcgcgttatgtttcccagcgtcga
gcggccgaaattaggcggcaaggatttatgggcatcgctatggcgcaggaagcagaaatt
gcctacactggattagtagatacgtggaaaaaactggatgacgaatttgaattgcgaaaa
aatggataa

DBGET integrated database retrieval system