KEGG   Coxiella burnetii RSA 493: CBU_0576Help
Entry
CBU_0576          CDS       T00124                                 

Gene name
yfcX
Definition
fatty oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBU_0576 (yfcX)
   01212 Fatty acid metabolism
    CBU_0576 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CBU_0576 (yfcX)
   00650 Butanoate metabolism
    CBU_0576 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    CBU_0576 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    CBU_0576 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBU_0576 (yfcX)
   00310 Lysine degradation
    CBU_0576 (yfcX)
   00380 Tryptophan metabolism
    CBU_0576 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBU_0576 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CBU_0576 (yfcX)
   00281 Geraniol degradation
    CBU_0576 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CBU_0576 (yfcX)
Enzymes [BR:cbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CBU_0576 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CBU_0576 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CBU_0576 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527562..529613
Genome map
AA seq 683 aa AA seqDB search
MKWQRGSKMRELQTYKHWKIKTDKDGILWLTLDREDTSVNSMNREVFTEFNKVLDEIAAQ
NPIAVILQSGKKKGFIAGADIKQFTDLKNKNEAFDLIRQAQLVLDKLEALPMPTVAMISG
FCLGGGLEVALACRYRVAEDNESTLIGLPEVKLGIHPGWGGTVRLSKLIGAPKAMEIMLP
GAAVPARKSAKLGMVDAAVPLRNLENAARYFALQKPPVHKPKGWEKYTNVSYIRPWLGRL
FYKKLSAKVEKTHYLAPYAIVHNWIKEGVGKEAYFTEAQSIAQLMMTESSRNMVRLFFLR
ERLKSLAKKTRYLPQQIHVIGAGVMGGDIAAWCALRGIRVTLHDKSAEKIAPAIKRAHAL
YEKKLKIPRLIQAAMDRLEPDVEGTGVKKADLIIEAVFEDIKVKQEVLSAIEPQLKPEAI
LATNTSSLSLDELSSVLKNPERLVAIHFFNPVAKLPLVEVASSQQTSADIAEKALAFVGA
IDKLPLAVSSSPGFLVNRALMAYLLEANRCLDEGFSMEQIDKAATDFGMPIGPIELADRI
GLDICLSVAQHLKNFYKHAEVSERLKTLVKEGHLGAKTGQGFYHYQNGRRVESKSTAEST
NPDLTDRLILQLVNEVKKCLDEKVIDKEDLADAGIVFGTGFAPFRGGPMQYAKSRGEADV
VKTLKRLAKQYGERFLPSEGWSA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatggcagcgagggagtaaaatgcgggaattacaaacttacaaacactggaaaata
aaaaccgataaagatggtattctttggttaaccctcgaccgtgaagatacatcggtaaat
tcaatgaatcgggaagtttttactgaatttaataaagtgctcgatgaaattgctgctcaa
aatcccatagccgttatccttcaatcaggaaagaaaaaaggattcatcgccggtgcagac
atcaaacaatttaccgatttaaaaaacaaaaatgaagcctttgatttaatccgccaagcg
cagctcgtccttgataagctcgaagcgctgcccatgccaaccgtagcgatgattagcgga
ttttgtttaggcggcggtttggaagtggcgcttgcctgtcgctatcgagtggcggaagat
aatgaatccacgctgattggattacccgaagtgaaattgggtattcatccagggtggggt
ggtaccgttcgattgtctaaattaatcggcgcgccgaaagcaatggaaattatgctgcca
ggtgcagcagttccggcgagaaaatctgctaagcttgggatggttgacgccgcagtaccg
cttcgtaatttagaaaatgccgctcgttatttcgctttgcaaaagccccccgtccataaa
ccgaaaggatgggaaaaatacacgaatgtaagttatattcgcccgtggttagggcggtta
ttttataaaaaactctctgcaaaagtggaaaaaacgcattacctggcgccatacgccatc
gtccataattggatcaaagagggggttggcaaagaagcctacttcacagaagctcagtcg
atcgcgcaattaatgatgaccgagagcagtcgcaacatggtgcgactgttttttttaaga
gaacgcttgaagtcgctcgctaaaaaaacgcgctatctgccgcaacaaattcacgttatt
ggcgctggtgtgatgggcggcgatattgcagcttggtgtgcgcttcgcggcatccgcgtg
actttacacgataaatcagcggaaaaaattgcgccggcgataaagcgggcgcatgctctt
tatgaaaaaaaattaaaaatcccgcgcttaattcaggcagcgatggaccgattagagccg
gatgtggaaggaacgggcgttaaaaaagcggatttaattattgaagctgtttttgaggat
ataaaagtaaagcaggaagttttaagtgctatcgaaccgcaattaaaacccgaggctatt
ttagcgactaacacgtccagtctttctttagatgaattaagttcggtgttaaaaaaccct
gagcgcttagtggctattcattttttcaatcccgttgctaaattaccgttggttgaagtg
gcaagcagtcagcagacatcggcggacattgctgaaaaagcgttagcgttcgtgggagct
attgataaattgccgttggcggtgagcagcagtccaggatttttagtcaatcgggcatta
atggcttatttattagaagcgaaccgttgtttagacgaagggttttccatggaacaaatt
gataaagcggcaactgattttgggatgcccataggtccgatcgagctagctgatcggatt
gggttagacatatgtttgtctgttgctcaacatctgaaaaacttttacaagcatgccgaa
gtttcagaacgattaaaaacattggttaaggaaggtcatctaggcgctaaaacgggtcaa
gggttttatcattatcaaaacggaagacgtgttgaatcaaagtctacagccgaatcaacg
aatcctgatttaaccgaccggttaatattgcaactcgttaatgaagtcaagaaatgtttg
gatgagaaagtgattgacaaggaagatttagccgatgcagggatcgtatttggcacgggg
tttgcaccgtttcggggtggaccgatgcagtatgccaagagtcgtggagaggccgatgtc
gtgaaaactttaaaacgcttagcaaaacaatacggtgaacgatttttgcctagcgaagga
tggtccgcatga

DBGET integrated database retrieval system