KEGG   Coxiella burnetii RSA 493: CBU_0599Help
Entry
CBU_0599          CDS       T00124                                 

Gene name
cysQ-1
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.25 3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cbu00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546409..547224
Genome map
AA seq 271 aa AA seqDB search
MGDDWLKPLVLLAKKAGAEILKYFGLSKEDLHVMQKEDRTPVTEADLSAHKILQKGLTAL
TPTIPILSEEGKIPPYAERQKWDRYWLLDPLDGTRGFIENRDEFTVNIALIERHEPVMGV
VYAPVFDLCYFASRGQGAFKQVAEETPISIQTRKMDEDSFSVLLGQYLRSPRLPELFNAI
SGCEIVRLNSSLKFCWIAEGKGDLYPRLGDTSEWDTGAGHCVLNEAGGTILELNGKELRY
NEKNSLMNPAFVAIGDVAQKEKVFELLERTP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgatgattggttaaaaccccttgttttattggcaaaaaaagccggtgctgaaatt
ttgaaatatttcggattgtctaaagaagacctgcatgtcatgcaaaaagaagaccgaaca
ccggttaccgaggccgatctttccgcgcataaaattctccaaaaagggctaaccgcgtta
acgccgactattccgattttatcggaagaagggaagattcccccttacgccgagcgtcag
aaatgggaccggtattggttattagatcctttagatggtacgcgaggatttatagagaat
cgcgatgaattcaccgttaatatcgctttaattgagcgacacgagcccgtgatgggtgtg
gtttacgcgcccgtatttgatttatgttacttcgcctctcgcggacaaggtgcttttaag
caagttgccgaagaaacacccatctctattcaaacgaggaagatggacgaagattcgttt
tctgttttattgggccaatacttacgctcgccccgcctcccggagctatttaacgctatc
tctggttgtgagatcgttcgattaaacagttctttaaaattttgttggatcgcggaagga
aaaggcgatttgtaccctcgccttggcgacaccagtgaatgggatacgggggcaggtcat
tgcgttctaaacgaggcgggcggtacgatccttgagttaaatgggaaagaattgcgatac
aacgagaagaattcccttatgaatccagcctttgtagcgatcggggatgtggctcaaaaa
gagaaagtattcgaattactcgaaagaactccataa

DBGET integrated database retrieval system