KEGG   Coxiella burnetii RSA 493: CBU_0701Help
Entry
CBU_0701          CDS       T00124                                 

Gene name
cysQ-2
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.25 3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CBU_0701 (cysQ-2)
Enzymes [BR:cbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CBU_0701 (cysQ-2)
Transfer RNA biogenesis [BR:cbu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CBU_0701 (cysQ-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650514..651347)
Genome map
AA seq 277 aa AA seqDB search
MIKMEAFIYSEKMLTSVIEIIKFAAKKILSIYSEPTSLVVTKKGDGSPLTKADQLAHDFI
SAQLTNLTPKIPIISEELDFEIYSNTLLNSYFWLVDPLDGTKDFIKRNGEFTVNIALIKD
AKVVLGVVFVPVTNTCYYANKVVGAFKQVGEQPPQQLQLTPQNKARDLNQPIKVAISRHH
GLDGIQKFIDKIGPCECVSMGSSLKICSLAEGEVDIYPRLGPTKEWDTAAAQCVLEQAGG
KILIETGKSLFYNKLDFLNPKFLALGSRGNPAWVTYL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattaagatggaagccttcatttatagtgaaaagatgttgacatctgtgatcgaaata
atcaagtttgctgcaaaaaagattcttagtatctatagtgaacccacttctttagtagtg
acaaagaaaggcgatggttccccgttaacaaaagctgatcaattggcacatgattttatt
tcagcgcaactcactaatttaaccccgaagattcccatcatttccgaagagttagatttt
gagatttattctaacacccttctaaattcttatttttggttggttgatcctttagacggg
accaaagactttattaaacgcaatggcgaatttactgttaatatagccttaatcaaagat
gcgaaagtagtactcggggtagtgtttgttcctgtaaccaacacttgttattatgcaaat
aaagtagttggcgccttcaagcaagttggagaacaaccaccccaacaattacaattgacc
ccgcagaacaaagcaagggatttgaatcaacctatcaaagtcgcaataagtcgccaccat
ggacttgatggcatacaaaaatttattgataaaattggtccttgcgagtgtgtcagcatg
ggcagtagcttgaagatatgctcgttagcagaaggggaagtagacatctacccgagatta
ggtcctacgaaagagtgggatacggctgcagcgcaatgcgttttagaacaagcgggcgga
aaaattctgattgaaaccggaaaatcattattttacaataaattggattttttaaatcca
aaattcttggctcttggtagtaggggaaatccagcttgggttacctatttataa

DBGET integrated database retrieval system