KEGG   Coxiella burnetii RSA 493: CBU_0840Help
Entry
CBU_0840          CDS       T00124                                 

Gene name
asnB-2
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBU_0840 (asnB-2)
Enzymes [BR:cbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CBU_0840 (asnB-2)
Peptidases [BR:cbu01002]
 Cysteine Peptidases
  Family C44
   CBU_0840 (asnB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792595..794508
Genome map
AA seq 637 aa AA seqDB search
MCGIVGFWDFRRSWKKEQYQKVAAKMADQITSRGPDSSGVWCDEKTGLAFGHRRLAVIDL
STAGHQPMLSHSGNTAIIYNGEIYNAPFIRRELENAGIYCCGHSDTEVLLEACELWGVKS
AVKKMNGMFAFAYWNKLEKKLYLGRDRLGIKPLFWSLKNNIFYFSSQLKALAAHPVWNVE
IDRTALTSYFRFNYIPAPLSIYKGVYKLKPGTILTIDPNQKIIEETFWSLETVCQKNINK
KKIDDNEVLEKTETLLRDAVKCRMYSDVPLGAFLSGGIDSSAVVALMQAQSTNRIKTFSI
GFYEKEYNEASYAKEVAQHLKTDHHELYLHVDEAARLIPQIPEWYDEPFADSSQIPTYLV
SQLARQHVTVSLSGDGGDELFAGYNRYLLAENLWSKLVRFPLWMRQSGSKTINFFSPSAW
DKFANVIPRKLRPSSVGDKAHKLAALLTQSSEDLYKGLVSLWERPAELVIDGSDISLWPE
PLPDLNFTERMQYIDTLTYLPDDILTKVDRASMAVSLEARIPLLDYRLVEYIWSLPMRFK
LERGETKWLLRRVLGKYVPEKLFTRPKMGFGVPIDHWLRCQLREWAEDLLSVPKLEKDGL
LHSSLIRQRWQEHLSGKRNWQYSLWSVLMFQLWRERW
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcggattttgggattttcgtcggtcttggaaaaaagagcaataccaa
aaagttgctgctaagatggcggatcaaattacttctcgaggcccagactcatcaggcgtt
tggtgcgacgaaaaaacgggactggcttttgggcaccgacggttagccgttattgatctt
tcgacagcagggcatcaacccatgttatcgcattcaggaaataccgccatcatttacaat
ggtgagatttataacgctccctttattcgtcgagaattagaaaatgcaggtatctattgt
tgcgggcattcagacactgaggtgcttctcgaagcctgtgaattatggggtgttaaatct
gcagtaaaaaaaatgaatggaatgttcgcctttgcttattggaacaaacttgaaaaaaag
ctgtatcttggtcgcgatcgtttaggaattaaaccgttattttggagcttaaaaaataac
attttttatttctcttcgcaattaaaagcactcgccgcgcatccggtttggaatgttgaa
attgaccggacggctttaacctcctactttcgatttaattatatccctgcgccattatca
atttacaagggtgtttataaactaaaaccaggcacgatactcaccatcgaccccaatcaa
aaaattattgaagaaaccttctggtcgttagaaacagtttgtcaaaagaatattaataag
aaaaaaattgacgacaacgaagtactagaaaagacggaaactctattgcgggacgctgtt
aaatgtcgtatgtactcggatgttccgctgggtgcctttttatccggtggtattgatagt
tctgccgttgttgctttaatgcaggctcaaagtacaaatcggattaaaactttttctatc
ggattctatgaaaaagaatataatgaggcttcttatgcgaaagaagttgcccaacatttg
aaaaccgatcatcacgaattatatttgcatgtggatgaagctgctcgattgattcctcaa
attccggagtggtatgacgagccatttgcagattcatcccaaatacccacttatcttgtt
tctcaattagcaaggcagcacgtaacggtaagtttatcgggcgacgggggtgatgaatta
tttgccggttataatcgctatcttttagccgaaaatttatggtccaaattagttcgattt
ccgctgtggatgagacagtcgggtagcaaaacgattaattttttcagtccttcagcgtgg
gataaatttgcaaatgtgataccacggaagttacgtccatcttctgtgggggataaggcg
cataagttagcggcgctattaacccaatcatcggaggatttatataaaggacttgttagc
ctttgggaaagaccggctgaattagtgattgatggttccgatatttccttatggccagag
ccgttgccggatttaaattttacggaacgaatgcagtacatcgataccctcacctattta
cctgatgatattttaacaaaagtagaccgtgctagcatggctgttagcttagaagcaagg
attcctttgttagactatcgattggtggaatacatttggtctttacccatgcgatttaaa
ttagaacgaggtgaaactaaatggttattgcgacgtgtattagggaaatacgtcccagag
aaattgttcactcgtcccaaaatgggctttggtgtgccgatcgatcattggttgcgttgt
caattgagagaatgggcagaggatttattatctgttcctaaactagaaaaagacggctta
ctgcattcctcattaattcgtcaacgctggcaggaacacctttctgggaaaagaaattgg
caatattcactttggagcgtgcttatgttccaattgtggcgtgagcgctggtga

DBGET integrated database retrieval system