KEGG   Coxiella burnetii RSA 493: CBU_0849Help
Entry
CBU_0849          CDS       T00124                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBU_0849 (galU)
   00052 Galactose metabolism
    CBU_0849 (galU)
   00500 Starch and sucrose metabolism
    CBU_0849 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CBU_0849 (galU)
Enzymes [BR:cbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CBU_0849 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
804280..805167
Genome map
AA seq 295 aa AA seqDB search
MKKVTTAVFPVAGLGTRFLPVTKAGPKEMLPIVDKPIIQYVVEEAIAAGITHLVFVTSSS
KRAIEDYFDSNYELETRLRSSRKLDALKLIQNLLPKEVRISYVRQAHPLGLGDAVLSAKH
VVGDQPFAVLLPDDIIDCGEKSCLQLMMEAFEKHQRNIIAVEQVPLNQTDKYGIVSVVDE
HQVKRITGMVEKPPLGSALSDWAVTGRYILSPRVFDHLDAISCGVGGEIQLTDAIVALLQ
EEQVLAFPFKGHRYDCGSRLGFLQATIAYALKRPEFKEPLREYLFKLLGSECVGG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcactactgccgtttttcctgtggccggattgggaacacgattcctgccg
gtaaccaaagcggggcccaaagaaatgttgccgattgttgataagccaattattcaatat
gtagtagaagaggcgatcgctgccggcattacgcatctcgtttttgtaacgagtagcagc
aagcgggctatcgaagattattttgatagtaattatgaattggaaacgcggttgcgctcc
agtaggaaactggatgccttgaaattaatacagaatctcttacccaaagaagttcgtatt
agctatgtgcgtcaagcgcaccctttaggcttgggtgatgcggtattatcggcgaaacat
gtcgtcggcgaccagccgtttgcggtattgttacccgatgacattattgactgcggtgag
aaaagctgtttgcaattgatgatggaagcttttgaaaagcatcaacggaatatcattgcg
gttgaacaggtgcctttaaatcaaaccgataaatatggcatcgtttctgtggtggatgag
caccaggtgaagcgaattactggtatggttgaaaaacctcccctcggaagcgcgttgtca
gattgggctgtcaccggccgctatattttgtctccacgtgtttttgatcatttggatgcc
atcagttgtggcgtggggggggagattcaactaacggatgcgattgtcgcgctgttgcaa
gaagagcaggtgcttgcctttcccttcaagggtcaccgttacgattgcgggagtcgattg
ggtttcttgcaggcgacgattgcttatgcgctcaaacggcctgaatttaaagagcccttg
cgggaatatttatttaaactgttgggctcggagtgcgtggggggttaa

DBGET integrated database retrieval system