KEGG   Coxiella burnetii RSA 493: CBU_0932Help
Entry
CBU_0932          CDS       T00124                                 

Gene name
gplK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CBU_0932 (gplK)
Enzymes [BR:cbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CBU_0932 (gplK)
Exosome [BR:cbu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBU_0932 (gplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882060..883604
Genome map
AA seq 514 aa AA seqDB search
MKTGTHLLKFRGLMSSFILAIDQGTTSTRAILFNEEAKLVHYHHVEITQYFPQGGWVEHD
PEEIWDSTLLCCRNVLEEASLRAADIAALGISNQRETTILWDRHTGQPLYRAIGWQDRRT
VNFCEQLASQAGVLAKFVEKTGLILDPYFSCSKIKWILDNIKGAYEKAKRGELAFGTVDS
YLLWKFTGGKCHATDATNASRTGLFNINQQRWDDELLTLFDIPKSLLPTVLDNCAQFGFT
DLDLLGHKIPITAMIGDQQAAAVGQACIKPGMVKSTYGTGCFMLLNTGDQIIHSRNRLLA
TIAYRLNDTVTYGLEGSIFIAGAAVKWLRDPLHLIEKANDSESMASSVEDTGGVYLVPAF
TGLGAPYWDPNARGALFGLTRNTQREHIVRAALEAVCYQSKDLVRAILNDGANLTTLRVD
GGMAANNWLLQFLSDILGVNVDRSRCIESSALGTAFLAGLGAGLFDSLEEMTGLWQADRH
FIPQMDPKKREELYDGWQKAVEKTLTPAAPLLFP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttgaagacagggactcatcttttaaagtttagggggcttatgagtagttttattttagcg
attgatcaaggtacaacaagcactcgcgctattctttttaacgaagaggccaagcttgtt
cattatcaccacgttgaaattactcaatatttcccgcaaggcggctgggtggagcatgat
cccgaagaaatctgggactcgaccctcctttgttgccgtaacgtacttgaagaagcttct
ttgcgtgctgccgatattgcagccctaggcatttctaaccaacgcgaaacgactattttg
tgggaccgccacactggccagccactttatcgtgctatcggctggcaagatcgtcgaacc
gtaaacttttgcgagcaattggcttctcaagccggggttctggctaagttcgttgaaaaa
acaggattaattctagatccttacttttcttgttctaaaattaaatggatactagacaat
attaaaggtgcttatgaaaaagcaaaacgcggtgagcttgcttttggcaccgtagattct
tatctcttatggaaatttactggcgggaaatgccacgcgacagatgccactaacgcgtca
cgaacggggctatttaatattaaccaacaacgatgggatgatgaattattaacgcttttt
gacattcctaaatcgctactccccaccgtacttgataattgcgctcaatttggcttcacc
gatctcgatcttttaggtcataaaattccaataaccgcaatgattggcgatcagcaagcg
gctgcggttggccaagcttgtattaaaccaggaatggtaaaaagtacttatgggacgggt
tgctttatgctgctcaatacaggcgatcaaattattcattcaagaaatcgactgttagct
accattgcttaccgtcttaatgacacagtgacttatgggctcgaaggcagcattttcatt
gcaggtgccgcagtaaaatggctgcgagatccgcttcacctcattgagaaagcgaacgat
agtgaaagtatggcctccagtgttgaggataccggcggggtttatttagtgcctgcgttc
accggtttgggagcaccttactgggaccccaacgcgcggggcgctttattcggtctgacg
cgcaacacccaacgagagcatattgttcgcgcggctctagaagccgtgtgttaccagagc
aaagacctcgttcgagcgatattaaatgacggcgcgaatttaactacgcttcgcgttgat
ggcggcatggcggccaataattggttattacaatttttgtctgatattctgggcgttaat
gtggatcgttcgaggtgcattgaaagcagtgcgttagggacagcctttctagctggctta
ggtgcgggtctttttgactcattagaagagatgacgggtttatggcaagccgatcgtcat
tttatccctcaaatggaccctaaaaaacgggaagaattatacgatgggtggcaaaaagcc
gttgaaaagacccttactcccgcagccccactcctttttccataa

DBGET integrated database retrieval system