KEGG   Coxiella burnetii RSA 493: CBU_1031Help
Entry
CBU_1031          CDS       T00124                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cbu  Coxiella burnetii RSA 493
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974769..975209
Genome map
AA seq 146 aa AA seqDB search
MKMTREYAKQALEFLKRHEGFSPHLYKDSVGKWTIGYGRNLEDDPLHEYEAEFLLMQDIE
RLDKALSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAVKEMLNS
EWAEEVKSRATELAQLMDSSWVQNVR
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatgactagagaatacgcaaaacaagcgctcgaattcctcaaacgacatgaaggt
ttttcacctcatctttacaaagacagcgtcggcaaatggacgatcggctatggtcggaat
ctcgaagacgatccgctgcatgaatacgaggctgaatttttacttatgcaagacatcgaa
cgccttgataaggcgctctcacttcacgaagcttatcaagcgcttgataacgaacgaaaa
gccatcatcctcgacatggcctataacttaggctatggaggattaatgaaattcacccat
ctgtggcaggcactagaaaaacaagactatgaacaagctgtgaaggaaatgcttaatagt
gaatgggccgaagaagtgaaaagccgagcgactgaattggcccaattgatggattcttct
tgggttcaaaatgtgcgctga

DBGET integrated database retrieval system