KEGG   Coxiella burnetii RSA 493: CBU_1154Help
Entry
CBU_1154          CDS       T00124                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CBU_1154 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBU_1154 (trpC)
Enzymes [BR:cbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CBU_1154 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1099660..1100433
Genome map
AA seq 257 aa AA seqDB search
MHDYLKAILKNKKQEIAHLKANFSSDAFSLSTKKSFKRIISSTPTTIIAEIKRRSPSKGH
LAEIADPVALAKQYVQGGAAGVSVLTDKLAFDGSIRDLQQVSLELRDRPVAVLRKDFILD
PLQIEEAAVAGADAILLIVAILKDATKILLQKAHECGLEALVEVHNRQELDQAIEIGAEI
IGVNNRNLTTFSVDPNNALKLKPYIPDHIISVAESGIHTVSDAKRYISAGYNAVLVGEAL
VKSENPQQFISAIKEND
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcatgattatttaaaagcaattcttaaaaataaaaagcaggaaattgcgcatttgaaa
gcgaatttctcttccgacgctttttctctttcaactaaaaaatcctttaaaagaataatt
tcttctacgcctacaactatcattgccgaaattaaacggcgttctccttcaaaaggacat
ttagccgaaattgctgatccagtcgccttggcaaagcaatatgttcaaggaggtgctgcg
ggagtatcagtccttactgataaacttgcctttgatggttccattcgtgatttacagcag
gtcagccttgaattacgcgacaggcctgtagctgtccttcgcaaagattttattttagac
cctctacaaattgaagaagctgctgtcgccggtgctgatgcgatattattaattgtagca
attttaaaagacgcaacaaaaattttattacaaaaagcgcatgaatgcggtcttgaagcg
ttagtggaagtgcacaatcgtcaagaattggatcaagctattgaaatcggtgctgaaatt
attggggtcaacaatcgaaacttaactaccttttcggttgacccaaataatgcgcttaaa
ctaaaaccttacattcccgatcacatcataagcgttgctgaatcgggaattcacaccgta
agcgatgcaaaacgttatatttctgctggttacaacgccgttctcgtgggagaggcatta
gttaaatcagaaaatcctcaacaatttattagcgctattaaagaaaatgattga

DBGET integrated database retrieval system