KEGG   Coxiella burnetii RSA 493: CBU_1155Help
Entry
CBU_1155          CDS       T00124                                 

Gene name
trpBF
Definition
bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CBU_1155 (trpBF)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBU_1155 (trpBF)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBU_1155 (trpBF)
Enzymes [BR:cbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CBU_1155 (trpBF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CBU_1155 (trpBF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1100426..1102228
Genome map
AA seq 600 aa AA seqDB search
MIEQPLIKICDIKDSALASRAVQMGADFIGIITYSKSKRYVNNKMAQNLSKAIRKAGGRP
VAVFVDFSAKAMESFCKSTGIDVVQLHGAISKAEHHLLPASLQRIYVLSVNKNGSILKDD
AGGLEHLDEKRDFLLFDNEIGGSGQSYDLNQFNYTGKFRYFLSGGLSPTNVNRAIQLTKP
QGVDVSSGVEDSNGNKKLTLIQSFITNVRKNPAGRFGTFGGCYVAETLMAPLQELQESMT
RIVKSNVFQTTFHDILQHYAGRPTPLTEAKRLSDFIQGPRIFLKREDLLHTGAHKINNSL
GQCLLAKKLKKTRIIAETGAGQHGVASATACAYFDLRCDIYMGAEDMKRQAPNVERMKLL
GANVIPVLAGSQTLKDAVNEALRDWSASYENTHYCLGSALGPHPFPEMVALFQSVIGKEA
KTQVHEQTGKQPDAIIACVGGGSNAIGIFSAFIDDPTVRLIGVEAGGKGNQLGEHAAWIK
HQRKGVLHGTYTYLLQDENGQIAKTHSISAGLDYPAIGPQHAFLFETGRAIYTSVSDKDA
LTAFKLLAKTEGIIPALESSHAIAYLLKEGRKKFSRKDIVIVNLSGRGDKDIPALKEYSL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagcccttgattaaaatctgcgatataaaagattcggcactggcaagcaga
gccgttcaaatgggagcggattttattggtatcattacctattcaaaatcaaaacgttat
gtaaataataaaatggctcaaaatctttcaaaagctattaggaaagcaggcggcagaccc
gttgctgttttcgttgatttttcagcaaaagccatggaatctttttgtaagtccacggga
atcgatgtcgtgcagttacatggcgctatttcaaaagccgaacatcatctattgccagca
tcattgcaacgcatttatgttctctccgttaataaaaacgggtcgattttaaaagacgac
gccggagggcttgagcatctagatgaaaaaagggattttcttttatttgataatgaaatt
ggcggaagtggccaatcctacgacctgaatcaatttaattatactggaaaattccgttac
tttttatcgggcggtctgtctcctacgaatgtaaatcgcgcaattcaattaacaaaacca
cagggcgtagacgtttccagtggtgttgaagatagtaacggcaataagaagttaacgctt
atccaatcttttattaccaatgtccgaaaaaatccggcagggcgctttggcacttttggc
ggttgctatgtcgctgaaactttaatggctcccctacaagaattacaagaatccatgacg
cgcattgtaaaatcaaacgtctttcaaaccacttttcacgatattttacaacattacgcg
ggtcgtccaacgccattaacggaagcaaaacgattgagtgattttattcaaggtccgcgt
atttttttaaagcgcgaagatttattacataccggcgcacacaaaataaataattccttg
ggacaatgtttgctggctaaaaaactgaaaaagactcgcatcatcgctgaaaccggcgcg
ggacagcacggggtggcgagtgcaactgcctgtgcttattttgatttgcgttgcgatatt
tatatgggcgccgaggatatgaaacgccaagcgcctaatgtagagcgaatgaagttatta
ggcgccaacgtgattcccgttttagctggatcacaaacattaaaagacgctgtcaacgaa
gcattacgtgattggtccgccagttatgaaaatacccactattgtttagggtcagcgcta
ggtccgcatccttttcctgaaatggtggctctttttcagtctgttattggtaaagaagcc
aaaactcaagtccatgaacaaacgggaaaacaacctgatgctattatcgcctgcgttggt
ggcggttcaaatgcgattggtattttttcagcgtttattgacgatccaaccgtaaggtta
attggcgttgaagcgggtggtaaaggcaaccaactgggcgagcatgccgcgtggattaaa
caccaacgcaaaggcgttctgcatggcacttatacttatcttttacaagatgagaatggc
caaattgcgaagacgcactctatttcggctggcttggattacccagcgatcgggccacaa
catgctttcctttttgaaacgggtcgggccatttataccagcgtcagcgataaagacgca
ttaaccgcatttaaattattagcaaaaacggaaggcattattccagcgctggagtcatct
cacgcgatagcttatttattaaaggaaggaaggaaaaaattttcgcgaaaagacattgtc
atcgtcaatttatcagggcgcggcgacaaagatattcctgcactcaaggagtatagttta
taa

DBGET integrated database retrieval system