KEGG   Coxiella burnetii RSA 493: CBU_1155Help
Entry
CBU_1155          CDS       T00124                                 

Gene name
trpBF
Definition
(RefSeq) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00260  Glycine, serine and threonine metabolism
cbu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01130  Biosynthesis of antibiotics
cbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBU_1155 (trpBF)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBU_1155 (trpBF)
Enzymes [BR:cbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CBU_1155 (trpBF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CBU_1155 (trpBF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PRAI
Motif
Other DBs
NCBI-GeneID: 1209057
NCBI-ProteinID: NP_820152
UniProt: Q83CG3
Position
1100616..1102418
Genome map
AA seq 600 aa AA seqDB search
MIEQPLIKICDIKDSALASRAVQMGADFIGIITYSKSKRYVNNKMAQNLSKAIRKAGGRP
VAVFVDFSAKAMESFCKSTGIDVVQLHGAISKAEHHLLPASLQRIYVLSVNKNGSILKDD
AGGLEHLDEKRDFLLFDNEIGGSGQSYDLNQFNYTGKFRYFLSGGLSPTNVNRAIQLTKP
QGVDVSSGVEDSNGNKKLTLIQSFITNVRKNPAGRFGTFGGCYVAETLMAPLQELQESMT
RIVKSNVFQTTFHDILQHYAGRPTPLTEAKRLSDFIQGPRIFLKREDLLHTGAHKINNSL
GQCLLAKKLKKTRIIAETGAGQHGVASATACAYFDLRCDIYMGAEDMKRQAPNVERMKLL
GANVIPVLAGSQTLKDAVNEALRDWSASYENTHYCLGSALGPHPFPEMVALFQSVIGKEA
KTQVHEQTGKQPDAIIACVGGGSNAIGIFSAFIDDPTVRLIGVEAGGKGNQLGEHAAWIK
HQRKGVLHGTYTYLLQDENGQIAKTHSISAGLDYPAIGPQHAFLFETGRAIYTSVSDKDA
LTAFKLLAKTEGIIPALESSHAIAYLLKEGRKKFSRKDIVIVNLSGRGDKDIPALKEYSL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagcccttgattaaaatctgcgatataaaagattcggcactggcaagcaga
gccgttcaaatgggagcggattttattggtatcattacctattcaaaatcaaaacgttat
gtaaataataaaatggctcaaaatctttcaaaagctattaggaaagcaggcggcagaccc
gttgctgttttcgttgatttttcagcaaaagccatggaatctttttgtaagtccacggga
atcgatgtcgtgcagttacatggcgctatttcaaaagccgaacatcatctattgccagca
tcattgcaacgcatttatgttctctccgttaataaaaacgggtcgattttaaaagacgac
gccggagggcttgagcatctagatgaaaaaagggattttcttttatttgataatgaaatt
ggcggaagtggccaatcctacgacctgaatcaatttaattatactggaaaattccgttac
tttttatcgggcggtctgtctcctacgaatgtaaatcgcgcaattcaattaacaaaacca
cagggcgtagacgtttccagtggtgttgaagatagtaacggcaataagaagttaacgctt
atccaatcttttattaccaatgtccgaaaaaatccggcagggcgctttggcacttttggc
ggttgctatgtcgctgaaactttaatggctcccctacaagaattacaagaatccatgacg
cgcattgtaaaatcaaacgtctttcaaaccacttttcacgatattttacaacattacgcg
ggtcgtccaacgccattaacggaagcaaaacgattgagtgattttattcaaggtccgcgt
atttttttaaagcgcgaagatttattacataccggcgcacacaaaataaataattccttg
ggacaatgtttgctggctaaaaaactgaaaaagactcgcatcatcgctgaaaccggcgcg
ggacagcacggggtggcgagtgcaactgcctgtgcttattttgatttgcgttgcgatatt
tatatgggcgccgaggatatgaaacgccaagcgcctaatgtagagcgaatgaagttatta
ggcgccaacgtgattcccgttttagctggatcacaaacattaaaagacgctgtcaacgaa
gcattacgtgattggtccgccagttatgaaaatacccactattgtttagggtcagcgcta
ggtccgcatccttttcctgaaatggtggctctttttcagtctgttattggtaaagaagcc
aaaactcaagtccatgaacaaacgggaaaacaacctgatgctattatcgcctgcgttggt
ggcggttcaaatgcgattggtattttttcagcgtttattgacgatccaaccgtaaggtta
attggcgttgaagcgggtggtaaaggcaaccaactgggcgagcatgccgcgtggattaaa
caccaacgcaaaggcgttctgcatggcacttatacttatcttttacaagatgagaatggc
caaattgcgaagacgcactctatttcggctggcttggattacccagcgatcgggccacaa
catgctttcctttttgaaacgggtcgggccatttataccagcgtcagcgataaagacgca
ttaaccgcatttaaattattagcaaaaacggaaggcattattccagcgctggagtcatct
cacgcgatagcttatttattaaaggaaggaaggaaaaaattttcgcgaaaagacattgtc
atcgtcaatttatcagggcgcggcgacaaagatattcctgcactcaaggagtatagttta
taa

DBGET integrated database retrieval system