KEGG   Coxiella burnetii RSA 493: CBU_1156Help
Entry
CBU_1156          CDS       T00124                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CBU_1156 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBU_1156 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBU_1156 (trpA)
Enzymes [BR:cbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CBU_1156 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1102245..1103048
Genome map
AA seq 267 aa AA seqDB search
MNRIEQQFKKSPAYVAYLTAGDGGLERSLESLLALAKGGVNILEVGVPFSDPVADGPVIQ
EASIRALAQGTTLHDVLTLITSFRQHSEIPIILFTYFNPLLAAGDKIYQQMKSAGVDGCL
VVDLPVEEAAPHLTACKTAKIAPILLISPSTTQERLKKINEHGEGMLYYVCRPGTTGVRA
TLPENFPAKMNQIKSMTSLPIVTGFGIANRKMAAQALQYADGFVIGSLFVKAIAEGISKN
ALTRLAQSLNPHYPNLRLITPFRKKTF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattgaacaacaatttaaaaagtctcctgcttatgtcgcttatttaacggcc
ggcgacggtggactggagcgttcgttagaaagtctattggctttagcaaaaggcggcgtt
aatattttagaagttggcgtcccgttttctgaccctgttgctgacgggccggtgattcaa
gaagccagcatccgtgcgctggctcaaggcactactttacacgacgtattaacgttaata
acgtcgtttagacaacacagtgaaattcccattattttatttacttattttaatcccctc
ttagcagccggcgataaaatttatcaacagatgaaatcggctggtgtggacggttgttta
gtcgttgatttacctgtagaagaagcagccccgcacctcactgcttgcaaaaccgcaaaa
attgctccaattttattaatctcaccctccacgacgcaagagcgtttaaaaaaaattaat
gagcacggagaaggaatgttgtattacgtatgccggcctggaacaaccggcgttcgagcc
accctgcctgaaaattttcccgctaaaatgaatcaaataaaatcaatgacgagcctaccc
atcgttaccggtttcggcatcgctaatcgaaaaatggccgcccaagcgttgcagtacgct
gacggttttgtaatcggttcgttatttgtaaaagcaatcgcagaaggaatcagcaaaaac
gcattaactcgtcttgcacaatcgctcaacccgcattaccccaacctacggctcatcacc
ccttttagaaaaaagaccttttag

DBGET integrated database retrieval system