KEGG   Coxiella burnetii RSA 493: CBU_1156Help
Entry
CBU_1156          CDS       T00124                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00260  Glycine, serine and threonine metabolism
cbu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01130  Biosynthesis of antibiotics
cbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBU_1156 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBU_1156 (trpA)
Enzymes [BR:cbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CBU_1156 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB Fe_dep_repress HTH_10
Motif
Other DBs
NCBI-GeneID: 1209058
NCBI-ProteinID: NP_820153
UniProt: Q83CG2
Position
1102435..1103238
Genome map
AA seq 267 aa AA seqDB search
MNRIEQQFKKSPAYVAYLTAGDGGLERSLESLLALAKGGVNILEVGVPFSDPVADGPVIQ
EASIRALAQGTTLHDVLTLITSFRQHSEIPIILFTYFNPLLAAGDKIYQQMKSAGVDGCL
VVDLPVEEAAPHLTACKTAKIAPILLISPSTTQERLKKINEHGEGMLYYVCRPGTTGVRA
TLPENFPAKMNQIKSMTSLPIVTGFGIANRKMAAQALQYADGFVIGSLFVKAIAEGISKN
ALTRLAQSLNPHYPNLRLITPFRKKTF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattgaacaacaatttaaaaagtctcctgcttatgtcgcttatttaacggcc
ggcgacggtggactggagcgttcgttagaaagtctattggctttagcaaaaggcggcgtt
aatattttagaagttggcgtcccgttttctgaccctgttgctgacgggccggtgattcaa
gaagccagcatccgtgcgctggctcaaggcactactttacacgacgtattaacgttaata
acgtcgtttagacaacacagtgaaattcccattattttatttacttattttaatcccctc
ttagcagccggcgataaaatttatcaacagatgaaatcggctggtgtggacggttgttta
gtcgttgatttacctgtagaagaagcagccccgcacctcactgcttgcaaaaccgcaaaa
attgctccaattttattaatctcaccctccacgacgcaagagcgtttaaaaaaaattaat
gagcacggagaaggaatgttgtattacgtatgccggcctggaacaaccggcgttcgagcc
accctgcctgaaaattttcccgctaaaatgaatcaaataaaatcaatgacgagcctaccc
atcgttaccggtttcggcatcgctaatcgaaaaatggccgcccaagcgttgcagtacgct
gacggttttgtaatcggttcgttatttgtaaaagcaatcgcagaaggaatcagcaaaaac
gcattaactcgtcttgcacaatcgctcaacccgcattaccccaacctacggctcatcacc
ccttttagaaaaaagaccttttag

DBGET integrated database retrieval system