KEGG   Coxiella burnetii RSA 493: CBU_1158Help
Entry
CBU_1158          CDS       T00124                                 

Definition
sterol delta-7-reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CBU_1158
Enzymes [BR:cbu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     CBU_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103871..1105238
Genome map
AA seq 455 aa AA seqDB search
MTPEVQHNASYRLLRYSLFPLFLITVCPPAAIIMWYTNVALNGSLTALAVLFTQKGFFTT
LYQIWSPVFFGTREAWFIISIFMITQLLLMRIVPGKRFEGPITPKGNVPVYKANGVLCFG
ITLTLFYLCAYQFRWFPPTIVYDHFGGILGALNIFSLIFCFILYFKGRFAPSTSDHSLSG
NFIFDYYWGTELYPRILGWDIKMFTNCRFGMMGWPIIILSFAAKQNQLYGLSNSMLVALL
IQLVYIGKFFWWERGYLRSLDIMHDRAGFYICWGCLVWVPSIYTSPLLYLVNHPIPLSWF
SADIILFLGVGCVFINYFADAQRQKVRASNGNCKIWGKKPALIRATYTTEQGKQKQTVLL
ASGWWGISRHFHYLPEIGAAFFWTVPALFSHFLPYFYVVYLTILLTHRSLRDENRCHKKY
GPDWEIYCQQVPSRIIPYFLTKRFNAMVKWRKSAN
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggaagtgcagcacaacgcgtcttatcgattattgcgttattctttgtttcca
cttttcttaattaccgtctgcccgcctgccgctattattatgtggtacacgaacgtcgct
ttgaatggttccttaacagcgctagctgttcttttcacgcagaaaggattttttaccact
ctttatcagatctggagtcctgtcttttttggcacgcgagaagcttggttcattattagt
atctttatgatcactcaattattactcatgcgaatagtccctgggaaacgtttcgagggt
cctatcacaccaaaagggaacgttcctgtctacaaagcgaatggggttttatgctttggt
attacgttgacgttattttacctttgtgcttatcaatttcgatggtttccgccgactatt
gtttacgatcattttggcggtattttaggtgcgttaaatatttttagtttaattttttgt
ttcattctttatttcaaagggcgttttgcaccctccacttccgatcatagtctaagcggt
aattttatttttgactattattggggaaccgaactatatccccgcattcttggatgggat
atcaaaatgttcaccaactgccgtttcggaatgatggggtggccgattattatcttgtca
tttgctgcaaaacaaaatcaattgtatggattaagcaattcgatgttagttgcgctattg
attcagttagtttatatcgggaaatttttttggtgggagagaggttatttgcgttcattg
gatatcatgcacgatcgagccggtttttatatctgttggggatgtttagtgtgggtcccg
agcatttatacttctcctctcttatatttagttaatcatcccattcccttaagctggttc
agtgcagatataattttatttttgggggtcgggtgtgttttcattaattattttgccgat
gcgcagcgccaaaaagttagagcctctaacggtaattgtaaaatttggggcaaaaagcct
gccctcattcgggccacttacacaacggagcaaggtaagcaaaagcaaacggtgttactg
gcttcgggctggtggggaatttctcggcattttcattacctcccggaaataggcgctgct
tttttctggacagtacctgcattattttcacattttttgccatatttttatgtagtttat
ttaactattttacttacgcatcgttcgctacgcgatgagaatcgttgccataaaaaatac
ggccccgattgggaaatttactgccaacaggtaccctctcggataattccttatttttta
actaaaagattcaatgctatggtaaaatggcgaaaatctgcaaattaa

DBGET integrated database retrieval system