KEGG   Coxiella burnetii RSA 493: CBU_1273Help
Entry
CBU_1273          CDS       T00124                                 

Definition
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00010  Glycolysis / Gluconeogenesis
cbu00030  Pentose phosphate pathway
cbu00051  Fructose and mannose metabolism
cbu00052  Galactose metabolism
cbu00680  Methane metabolism
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBU_1273
   00030 Pentose phosphate pathway
    CBU_1273
   00051 Fructose and mannose metabolism
    CBU_1273
   00052 Galactose metabolism
    CBU_1273
  Energy metabolism
   00680 Methane metabolism
    CBU_1273
Enzymes [BR:cbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CBU_1273
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CBU_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Sirohm_synth_M
Motif
Other DBs
NCBI-GeneID: 1209178
NCBI-ProteinID: NP_820266
UniProt: Q83C58
Position
1223442..1224704
Genome map
AA seq 420 aa AA seqDB search
MSKKNVFYAQSGGATAVINATACGVIQTAAQYPTKIGKVLAGRNGIIGALKEELIDTSLE
SLENIAALRHTPSSAFGSCRYKLNNIHHDRRQYERLIEVFKAHDIGYVFYNGGGDSQDTT
HKISQLSQLMDYPLVCIGLPKTIDNDLPFTDNCPGFGSVAKYIAVSTQEAALDVRGMCAT
STKIFILEVMGRHAGWIAASSALGKSQPDDAPHLILFPEVPFQTEQFLTKVSRSVEKNGY
CVIVASEGIRHPDGRFVAESGLHDAFGHEQLGGVAPILARLIKKRLNFKYHWAVADYLQR
AARHIASQTDLDQAYALGKTAVEFALAGKSDVMLTIQREMGSDYKWRIGTAPLCEVANVE
HKMPSHYISEDGFGITEACYTYLKPLIEGESYPPYKNGVPDYVTLKNQLVAKKLKEAFAV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaacgtcttctacgcccaatcgggcggtgccacggcggtgattaatgcg
acagcctgcggagtcatacaaacagccgctcaatatcccactaaaattggaaaagttctg
gcgggacgtaacgggattattggtgctcttaaagaggagctcattgataccagtctggag
tctcttgaaaatatcgctgctttgcggcacaccccttcgagcgcttttgggtcctgccgc
tataaactgaacaatatccatcacgatcgccgtcaatatgagcggcttatcgaagttttt
aaagcgcatgatatcggctacgtgttttacaacggcggtggcgattcccaagacaccacg
cataaaatttcgcagttaagccaactaatggattatcccctggtttgcattggtctaccc
aaaaccatcgataacgatctcccttttactgataattgtccgggctttggttctgttgct
aaatatattgctgtttccactcaagaagcggctttggatgtacgcggtatgtgtgcgacc
tcgaccaagatttttattctggaggtcatggggcgccatgcgggctggattgcggcgtcg
tctgcattgggaaaatcccaacctgacgacgcgccacacttgattctatttcccgaagtt
cccttccaaaccgaacaattcctaacaaaagtaagcagatccgttgaaaaaaatgggtat
tgtgtcattgtggcttctgaaggtatccgtcatcccgacggacgatttgtagcggaatcc
ggattgcacgacgcttttggccatgaacaattaggcggggtggcacctattttagcaagg
ctgatcaaaaaacgacttaattttaaataccattgggccgttgcggattatttacaacga
gcggcccgccacattgcctctcaaacggatcttgatcaagcgtacgctctaggaaaaacc
gccgtggaattcgcgcttgctggaaaatccgatgtgatgctcaccatccaacgcgaaatg
ggttctgattataagtggcgcatcggcacggctcccttgtgcgaagtcgctaatgtggag
cacaaaatgccaagccattatatcagcgaagacggatttggcatcacagaagcttgctat
acgtatcttaaacctctgattgaaggggaaagctaccccccttataaaaatggggtaccc
gattacgtcaccctaaaaaaccagttggttgcaaagaaattgaaggaagcttttgctgtt
tag

DBGET integrated database retrieval system