KEGG   Coxiella burnetii RSA 493: CBU_1398Help
Entry
CBU_1398          CDS       T00124                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cbu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cbu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cbu00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1350133..1351350)
Genome map
AA seq 405 aa AA seqDB search
MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV
AKEGEVVKADQILALLKEGGAVAKEKEKKDEKETKKEKEKKEEKKDKEKKEKTEEKESDL
SPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQKEKPSEGKEGPADERTEKRVP
LSRIRQRVAERLVQVQQEAALLTTFNEINMQLVMELRKKYREEFEKKFKVRLGFMSFFTK
AVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIVPILRNAEKMNMADIEKQIR
EYASRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPPQTAILGMHKIMDRPTVENG
EVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARMILEC
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatagaaattaaagtacctacgttgcctgaatcggttagcgatgccacggttgca
aagtggtataaaaaagaaggcgattccatttcacgggatgaaaatctagtcgatttggaa
acggataaagtcatgttggaggttcccgccccgaaagacggtgtggttgaaaaaatcgtc
gcgaaagaaggcgaagtcgttaaagccgatcaaatccttgcccttttaaaagaaggcggc
gctgtggccaaagaaaaagaaaagaaagacgaaaaagaaacgaaaaaagaaaaagagaaa
aaagaagaaaagaaagataaggaaaaaaaggaaaaaactgaagaaaaagaatctgatctc
agtcccgccgtgcgacgtatggtttcggaaaaagacgttgatgtcgaggaaattgaagga
agtggaaaaggagggcggattacgaaaaaagacgtggaagattatttagaaaaacaaaaa
gagaaaccctccgaaggaaaagaagggcctgccgatgaacgcacggaaaaacgcgtgcct
ttatcccgcatccggcaacgtgttgcggagcggttagtgcaagtccaacaagaagcggct
ttattaacgacgtttaatgaaattaacatgcagctggtaatggagttgcgaaaaaaatac
cgcgaagagttcgaaaagaaattcaaagttcgattgggttttatgtccttttttaccaaa
gccgtcgttgaagcgttaaaacgttttcccatggtaaacgcctcgatcgatggtagtgat
attatttatcacaattattacgacatcggtattgctattggcactgaacgcggattaatt
gtccctattcttagaaacgccgaaaaaatgaatatggccgatattgaaaaacaaattcgt
gaatacgcttctcgagctcaagaaggtcgtttgaatattgaggaactaacgggaggcact
tttacaattacgaatggcggaacttacggctcgcttctctcaacgcctataattaatccg
ccccaaaccgctattttggggatgcataaaataatggaccgtccaacggttgaaaacgga
gaagtcgtggttcgtccgatcatgcaagtggcattatcttacgatcatcgggtgattgac
gggcgagaagccgtgttatttttagtgaccattaaagagcttttggaagatccagctcga
atgattttggagtgttaa

DBGET integrated database retrieval system