KEGG   Coxiella burnetii RSA 493: CBU_1450Help
Entry
CBU_1450          CDS       T00124                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00010  Glycolysis / Gluconeogenesis
cbu00051  Fructose and mannose metabolism
cbu00562  Inositol phosphate metabolism
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
cbu01230  Biosynthesis of amino acids
Module
cbu_M00002  Glycolysis, core module involving three-carbon compounds
cbu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBU_1450 (tpiA)
   00051 Fructose and mannose metabolism
    CBU_1450 (tpiA)
   00562 Inositol phosphate metabolism
    CBU_1450 (tpiA)
Enzymes [BR:cbu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CBU_1450 (tpiA)
Exosome [BR:cbu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CBU_1450 (tpiA)
  Exosomal proteins of bladder cancer cells
   CBU_1450 (tpiA)
  Exosomal proteins of melanoma cells
   CBU_1450 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1209358
NCBI-ProteinID: NP_820433
UniProt: Q83BQ3
Position
complement(1402287..1403102)
Genome map
AA seq 271 aa AA seqDB search
MIPLEWRQISAWRGCHMQRRPLVAGNWKMHGSRESVGQLLRALKHGCERLETAELAVFPP
FVFLQQCEEALMRTQISWGAQDVSEFERGAYTGEVSAAMLRDFHCRYVIVGHSERRQRHG
ETNEQVAAKVRAALRCGIRPIICVGETEKQRNANQTLSVIKEQLAVVLQMNDNLASLEGM
VVAYEPIWAIGTGKNATPSQAEEVHAALRDQLHRQDATLAESTRLLYGGSVKPDNAAALF
EMPNIDGALVGGASLEAEQFLKIGQQCNQSF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgctagaatggcgccagatttcagcatggagaggatgtcatatgcagcgtcga
ccgttagtggctggtaattggaaaatgcatggttcgcgcgaaagtgtgggtcaattatta
agggcattaaaacacggttgcgagcgtctggaaacggcggagctcgctgttttcccccct
tttgtctttttgcagcaatgcgaagaggcgctgatgcgaacgcaaatctcttggggtgcg
caggacgtttccgaattcgaaagaggcgcttatacgggggaagtctctgctgccatgctg
cgcgatttccattgccggtatgtaatcgtcggccactcggaaaggcgtcagcgtcacgga
gaaaccaatgagcaagtggctgcgaaggttagggcagccctccgttgcggcattcgtcct
attatttgtgtaggggaaactgaaaagcagcgcaatgctaatcagacattatcagtgata
aaagagcaacttgcagttgtattgcagatgaacgataatttggcgtcgttggaaggcatg
gtggtggcttatgagccgatatgggcgattggaaccggaaaaaatgcaacgccttcgcaa
gcagaagaagtgcacgcagcccttcgagatcaattacaccgtcaggatgcgacactagcc
gaaagcacgcggcttttatatgggggcagtgttaagccggataatgcagccgctttgttt
gaaatgccaaatatagatggcgctttagtgggtggggcttctttggaagctgaacaattt
ctaaaaatagggcaacaatgcaatcaatcattttaa

DBGET integrated database retrieval system