KEGG   Coxiella burnetii RSA 493: CBU_1568Help
Entry
CBU_1568          CDS       T00124                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1515403..1516005
Genome map
AA seq 200 aa AA seqDB search
MIGHLRGIIVEKQPPYLLLEVAGVGYEITAPLSTFYHLPEPQEEILLYTHLIVREDAHTL
YGFHNDHERRLFRALIKVNGVGPKLALAILSGIGPDEFVHCVLNQNIDQLVRIPGVGRKT
AERLVIETKDGLSRWHTNDTPSPEGLRSSNTQPTQDAISALMALGYKPQEAKRAIDAIQK
PDLSAETLIRLALKQMVLGT
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccatttgcggggaatcattgtagaaaaacaacccccttatttgttattagaa
gtcgccggcgtcggttacgaaatcaccgctcctttgtcaactttttaccacttaccggag
ccccaagaagaaatcctgctttatactcatttgatcgttcgcgaagatgcccacacgctg
tatggttttcataacgaccacgagcggcgactttttcgcgctttgatcaaagtcaatggc
gttggaccaaaactggctttagcgattttatcgggcatcggaccagacgaatttgtccac
tgcgttctgaatcaaaacatcgaccaactcgtgcgcatccccggcgtgggacgaaaaacc
gccgaacgcttagtcatcgaaacaaaagacggattaagccgctggcacaccaacgatacg
ccttcaccagaaggactacgctcatccaacacccagccgacccaagacgccatcagcgcc
ttaatggcccttggttacaaaccccaagaagccaaacgcgccatcgacgcaatccaaaaa
cccgacctttcagcggaaacgttgattcggttggcgttaaaacaaatggtgttaggcact
tag

DBGET integrated database retrieval system