KEGG   Coxiella burnetii RSA 493: CBU_1838Help
Entry
CBU_1838          CDS       T00124                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CBU_1838 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CBU_1838 (rfbC)
Enzymes [BR:cbu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CBU_1838 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767789..1768358)
Genome map
AA seq 189 aa AA seqDB search
MPFEFQKMLIPEVILIKPKVFTDDRGFFIETFKQSDFRRHGINGEFLQDNHSLSMKKGVL
RGLHYQLDPHAQGKLVRVVLGKVFDVAVDLRRESPTFGKWVSTELSSTNNHMLWIPPGFA
HGMLVLEENTHLLYKCTAEYVPESERYIRWDDPDINIKWPIKNNLLLSEKDAAGVFLQRA
EINAQYHGS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaatttcaaaaaatgcttattcctgaagtcattttgattaaacccaaagtt
tttacggatgaccgaggcttttttatagaaaccttcaagcaaagcgattttaggcgccat
ggtattaatggggaatttttgcaagataatcattctttatcaatgaagaaaggcgtattg
agaggattacattaccaactggaccctcatgcgcaaggaaaattagtgcgtgtggtttta
ggtaaagtattcgatgtagccgttgatttacgacgggaatcaccgacattcggaaaatgg
gtttccacagaactttcttctaccaataatcacatgctctggatacctcctggttttgct
catggtatgctggtattggaggaaaatacacatttattatataagtgcacagcagagtat
gttcccgaatcagagagatacattcgttgggacgaccctgacattaatattaagtggccg
atcaaaaataatcttttgctttctgaaaaggatgcggcgggggtatttttgcaacgggca
gaaattaacgcgcaataccacgggagttga

DBGET integrated database retrieval system