KEGG   Clostridium baratii: U729_1621Help
Entry
U729_1621         CDS       T03506                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbv  Clostridium baratii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cbv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    U729_1621 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    U729_1621 (thlA)
   00640 Propanoate metabolism
    U729_1621 (thlA)
   00650 Butanoate metabolism
    U729_1621 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    U729_1621 (thlA)
   00072 Synthesis and degradation of ketone bodies
    U729_1621 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U729_1621 (thlA)
   00310 Lysine degradation
    U729_1621 (thlA)
   00380 Tryptophan metabolism
    U729_1621 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U729_1621 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U729_1621 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    U729_1621 (thlA)
Enzymes [BR:cbv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U729_1621 (thlA)
Exosome [BR:cbv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U729_1621 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1713963..1715141
Genome map
AA seq 392 aa AA seqDB search
MREVVIVSAVRTAIGSFGGSLKNVPAVDLGATVIQEAVKRAGIKPEMVEEVVMGNVIQAG
LGQNVARQATIKAGLPEQVPAMTINKVCGSGLRTVALAAQMIKAGDADIIVAGGMESMSQ
APYLLKTARWGQRMGDGKMVDAMINDSLWDAFNNYHMGVTAENIAKQWNLTREEQDQFAL
QSQLKAEKAVKEGKFKDEIVPVVIPQRKGEPVVFDTDEFPRFGSTIEGLSKLRPAFIKDG
TVTAGNASGINDGAAAFVVMSAEKAESLGLKPMAKILSYGSKGLDPAIMGYGPFHATKKA
LEGTGLTVDDMDLIEANEAFAAQSLAVAKDLKFDMSKVNVNGGAIALGHPVGASGARILV
TLLYEMQKRDAKKGLATLCIGGGMGTALIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagtaatagtaagtgcagtaagaactgctataggttcttttggaggttct
ttaaagaacgttcctgcagtagatttaggagcaacagttattcaagaagctgttaagaga
gctggcattaagccagaaatggtagaagaagttgtaatgggtaatgttattcaagcaggt
cttggccaaaatgttgcaagacaagcaacaataaaagctggattaccagaacaagtacca
gctatgacaattaataaagtttgtggttcaggtttaagaacagttgctttagctgctcaa
atgataaaagctggagatgctgatataattgtagcaggtggaatggaaagcatgtcacaa
gcaccataccttttaaaaactgctagatggggtcaaagaatgggagacggaaaaatggtt
gatgcaatgatcaacgattcattatgggacgccttcaacaattaccacatgggagtaaca
gctgaaaacatagctaaacaatggaacttaacaagagaagaacaagatcaatttgctctt
caatcacaattaaaagctgaaaaagcagtaaaagaaggaaaattcaaagatgaaatagtt
ccagtagtaattccacaaagaaagggagaaccagtagtatttgatactgatgaattccca
agatttggttcaacaatagaaggattatcaaaattaagaccagcattcattaaagatggt
actgtaacagctggtaatgcttcaggtataaatgatggagcagctgcatttgtagtaatg
agcgcagaaaaagctgaaagcttaggattaaaaccaatggctaaaatcctttcatacggt
tcaaaaggattagatccagcaataatgggatatggaccattccatgcaactaagaaagct
ttagaaggaactggattaacagttgatgatatggatcttatagaagcaaacgaagctttc
gcagcacaaagcttagctgtagctaaagatttaaaatttgatatgagcaaagttaacgta
aatggtggagctattgcgttaggacacccagtaggagcttcaggagctagaatattagtt
acattattatacgaaatgcaaaagagagatgctaagaaaggtttagcaacactttgtata
ggtggcggaatgggaactgctcttatagttgaaagataa

DBGET integrated database retrieval system