KEGG   Symbiobacter mobilis: Cenrod_0688Help
Entry
Cenrod_0688       CDS       T02877                                 

Gene name
alaA
Definition
(GenBank) alanine-synthesizing transaminase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cbx  Symbiobacter mobilis
Pathway
cbx00220  Arginine biosynthesis
cbx00250  Alanine, aspartate and glutamate metabolism
cbx00290  Valine, leucine and isoleucine biosynthesis
cbx01100  Metabolic pathways
cbx01110  Biosynthesis of secondary metabolites
cbx01130  Biosynthesis of antibiotics
cbx01210  2-Oxocarboxylic acid metabolism
cbx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cenrod_0688 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    Cenrod_0688 (alaA)
   00220 Arginine biosynthesis
    Cenrod_0688 (alaA)
Enzymes [BR:cbx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Cenrod_0688 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     Cenrod_0688 (alaA)
Amino acid related enzymes [BR:cbx01007]
 Aminotransferase (transaminase)
  Class I
   Cenrod_0688 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGX86795
UniProt: U5N672
Position
complement(743504..744733)
Genome map
AA seq 409 aa AA seqDB search
MLKTVRKSAKLAHVCYDIRGPIMDAARQMEEEGHKIIKLNLGNLALFGFDSPEEIQQDMI
RNLPNSAGYSDSKGIFAARKAVMHETQRQGIVGVTLDDIYLGNGASELIVAATNGLLDDG
DEILVPSPDYPLWTAAASLSGGTPVHYLCNEAQGWMPDLADIRAKITPRTKALVVINPNN
PTGALYGEDMLRSLVQIARENGLVLFADEVYDKVLYDGARHTALASLSTDVLTLTFNSLS
KSYRSCGYRAGWMIVSGDKKAARDYIEGLNMLSNMRLCSNVPGQWAIQTALGGYQSIVDL
VGEGGRLRRQRDLAYELLTAIPGISCVRPSAALYMFPRLDPTVYPIEDDQQFFLELLQET
KVMLVQGTGFNWPAPDHFRMVFLPHEDELRVAIGRIARFLESYRKRYSN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaccgtacgcaaatccgccaagctggcccatgtctgctatgacatccgtggc
cccatcatggacgccgcgcgccagatggaggaagaaggccacaaaatcatcaagctcaac
ctgggcaacctggcgctcttcggcttcgattcgcccgaagagattcagcaggacatgatc
cgcaacctgcccaattcggcggggtattccgacagcaaaggcatcttcgcagcacgcaag
gccgtgatgcatgaaacccagcgccagggtatcgtgggcgtcaccctcgatgacatctat
ctgggcaatggcgccagcgagctgatcgtcgcggcgaccaacggactgctggacgacggc
gacgaaatcctggttccctcgcccgactatcccttgtggactgctgcggccagcttgtcc
ggcggaacccctgtccactacctctgcaacgaagcccaagggtggatgcccgaccttgcc
gacatccgagccaagatcaccccgcgcaccaaggcgctcgtcgtcatcaaccccaacaac
cctaccggcgcgctgtatggggaggacatgctccgttccctcgtgcaaatcgcccgggaa
aacggtctcgtcctctttgccgacgaggtgtacgacaaggtgctgtacgacggtgcccgg
cacactgcgctggcttcgttgagcacggatgtgctgaccctgacgttcaactcgctgtcc
aaaagctaccgttcctgcggctaccgcgccggatggatgatcgtcagcggtgacaagaaa
gccgcgcgcgactacatcgaagggctgaacatgctctcgaacatgcgcctgtgctcgaac
gttccggggcagtgggccattcagactgcgctgggcgggtaccagagcatcgtcgacctc
gtcggcgaagggggcaggctgcgccgccagagagatctggcctacgagttactgactgcc
attcccggcatcagttgcgtgcgccccagtgccgcgctctacatgtttccgcgcctcgat
cccacggtctaccccattgaggacgaccagcagttttttctggaactgttgcaggaaacc
aaggtcatgctcgtgcaaggaactgggttcaactggcctgctcccgaccacttccggatg
gtcttccttccccatgaagacgagctgcgggtcgccattggccgcatcgcacgctttctg
gagtcctatcgcaaacgctacagcaattga

DBGET integrated database retrieval system