KEGG   Symbiobacter mobilis: Cenrod_0688Help
Entry
Cenrod_0688       CDS       T02877                                 

Gene name
alaA
Definition
alanine-synthesizing transaminase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cbx  Symbiobacter mobilis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbx00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Cenrod_0688 (alaA)
   01230 Biosynthesis of amino acids
    Cenrod_0688 (alaA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cenrod_0688 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    Cenrod_0688 (alaA)
Enzymes [BR:cbx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Cenrod_0688 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     Cenrod_0688 (alaA)
Amino acid related enzymes [BR:cbx01007]
 Aminotransferase (transaminase)
  Class I
   Cenrod_0688 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(743504..744733)
Genome map
AA seq 409 aa AA seqDB search
MLKTVRKSAKLAHVCYDIRGPIMDAARQMEEEGHKIIKLNLGNLALFGFDSPEEIQQDMI
RNLPNSAGYSDSKGIFAARKAVMHETQRQGIVGVTLDDIYLGNGASELIVAATNGLLDDG
DEILVPSPDYPLWTAAASLSGGTPVHYLCNEAQGWMPDLADIRAKITPRTKALVVINPNN
PTGALYGEDMLRSLVQIARENGLVLFADEVYDKVLYDGARHTALASLSTDVLTLTFNSLS
KSYRSCGYRAGWMIVSGDKKAARDYIEGLNMLSNMRLCSNVPGQWAIQTALGGYQSIVDL
VGEGGRLRRQRDLAYELLTAIPGISCVRPSAALYMFPRLDPTVYPIEDDQQFFLELLQET
KVMLVQGTGFNWPAPDHFRMVFLPHEDELRVAIGRIARFLESYRKRYSN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaccgtacgcaaatccgccaagctggcccatgtctgctatgacatccgtggc
cccatcatggacgccgcgcgccagatggaggaagaaggccacaaaatcatcaagctcaac
ctgggcaacctggcgctcttcggcttcgattcgcccgaagagattcagcaggacatgatc
cgcaacctgcccaattcggcggggtattccgacagcaaaggcatcttcgcagcacgcaag
gccgtgatgcatgaaacccagcgccagggtatcgtgggcgtcaccctcgatgacatctat
ctgggcaatggcgccagcgagctgatcgtcgcggcgaccaacggactgctggacgacggc
gacgaaatcctggttccctcgcccgactatcccttgtggactgctgcggccagcttgtcc
ggcggaacccctgtccactacctctgcaacgaagcccaagggtggatgcccgaccttgcc
gacatccgagccaagatcaccccgcgcaccaaggcgctcgtcgtcatcaaccccaacaac
cctaccggcgcgctgtatggggaggacatgctccgttccctcgtgcaaatcgcccgggaa
aacggtctcgtcctctttgccgacgaggtgtacgacaaggtgctgtacgacggtgcccgg
cacactgcgctggcttcgttgagcacggatgtgctgaccctgacgttcaactcgctgtcc
aaaagctaccgttcctgcggctaccgcgccggatggatgatcgtcagcggtgacaagaaa
gccgcgcgcgactacatcgaagggctgaacatgctctcgaacatgcgcctgtgctcgaac
gttccggggcagtgggccattcagactgcgctgggcgggtaccagagcatcgtcgacctc
gtcggcgaagggggcaggctgcgccgccagagagatctggcctacgagttactgactgcc
attcccggcatcagttgcgtgcgccccagtgccgcgctctacatgtttccgcgcctcgat
cccacggtctaccccattgaggacgaccagcagttttttctggaactgttgcaggaaacc
aaggtcatgctcgtgcaaggaactgggttcaactggcctgctcccgaccacttccggatg
gtcttccttccccatgaagacgagctgcgggtcgccattggccgcatcgcacgctttctg
gagtcctatcgcaaacgctacagcaattga

DBGET integrated database retrieval system