KEGG   Clostridium botulinum A2: CLM_0039Help
Entry
CLM_0039          CDS       T00883                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cby  Clostridium botulinum A2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cby00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLM_0039 (recR)
DNA repair and recombination proteins [BR:cby03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CLM_0039 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
34573..35169
Genome map
AA seq 198 aa AA seqDB search
MDFYPIAIEKLIEEFAKLPGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSV
CGNFTDKDPCAICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPMAGRGP
EDIKLKELIRRIDGSVNEVIVATNPNVEGEATAMYISKILKPLGVKVTRIAHGVPVGGDL
EYADEVTLAKALEGRIEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggatttttatcctatagctatagaaaaattaatagaagagttcgctaaattaccgggt
ataggttataaaacagctcaaagacttactctatatgtactaaatttacctaaagaagag
gtaaaggaattctcagaggctttagtaaaagctagaggtacaattaaatattgttctgta
tgtggtaattttacagataaagatccttgtgctatatgtagtaatcctaataggaataaa
tctattatttgtgtaatagaacaacctaaagatataatgtctatggaaaaaataagagaa
tataatggagtatatcatgtattacatgggaatatatctcctatggcaggaagaggtcct
gaagacataaaattaaaagaattaataagaagaatagatggtagtgtaaatgaagttata
gttgctactaatcctaatgtagaaggagaagcaacagctatgtatatatctaaaatatta
aaacctctaggagttaaagttacaagaattgcccacggagtaccagtaggtggggattta
gaatatgcagatgaggttactttagctaaagctttagaaggaagaatagaattataa

DBGET integrated database retrieval system