KEGG   Clostridium botulinum A2: CLM_0217Help
Entry
CLM_0217          CDS       T00883                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cby  Clostridium botulinum A2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cby00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLM_0217
Enzymes [BR:cby01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLM_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
196598..198832
Genome map
AA seq 744 aa AA seqDB search
MQEIQGFIEDILFKNDENGYVVAKIRKKKELITIVGCMPYITEGQNLKLKGEWVIHPQFG
NQFKVEVCEEIVPDTVAGIERYLSSGIISGIGPVTAKKIVKKFGEETLNILDSNIERLTE
IEGIGKKKIEVIYDSYIKQNEVRNIMMFFQNYGVTPNQCMKVYKRFGENSISIVKENPYI
LTEEIRGIGFKTADKIARSLGIASNSPFRIQSGINYIINGFCSLGNTYMPLEKLVSEAMD
ILGVREEEIHENIYNNIAENKLKIEKVKEQSCVFTLPYYYCELGVTKKILSLSLSQYDNL
NINIEDEIVSFEKNNNIKFHDSQREAIKGALENGVEIITGGPGTGKTTIINCITEIFEKA
NMKVYMAAPTGRAAKRMSETTGREAKTIHRMLEMGVSEDDTEEVFSKGEETPLECDVVII
DEASMIDIILMNTLLKAIALGTRIIIVGDVDQLPSVGPGNVLRDLIESKCVKVVRLKEIF
RQSKESMIIVNAHRINDGEMPIINKKDKDFYFIECSEPKKIVNTLLELSNRRLPKFNKSW
HKIHDIQILSPMRKGVLGVSSLNKELQSVLNPKNDSKKEMEFKDYIFRVGDKVMQTKNNY
SLKWTRASGEGEAEGLGIFNGDVGYIEDIDEEKETIQVLFDNERRVIYENLYLDEIDLAY
AVTIHKSQGSEFPVVIMPAFKGPPLLMNRNLLYTGITRAKRLVVLVGSLKSINFMVQNDK
IFERYSLLKWRISNILDTEIINGE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatacagggatttatagaggatatactttttaaaaatgatgaaaatgggtat
gtagtggcaaaaataaggaagaagaaagagcttataaccatagtcggatgtatgccctac
ataacagaaggacaaaacttaaaattaaaaggtgaatgggtaattcatccacaatttggt
aatcaattcaaagtagaagtatgtgaagaaatagtacccgatactgtagctggtatagaa
agatatttatcctcaggaatcatatcaggtataggcccagtgactgcaaaaaaaattgtg
aaaaaatttggagaagaaacattaaatatattagacagtaatatagaaagattaacagag
atagagggaataggaaagaagaagatagaggtaatatatgattcctatataaaacaaaat
gaagtgcgaaatataatgatgttttttcaaaattacggagttacacctaaccaatgcatg
aaagtttataaaagatttggagaaaattctatatcaatagttaaagagaatccatatata
cttacggaagaaataagaggaataggtttcaagacagcagataaaatagctaggagctta
ggaatagcctctaattcaccttttagaattcagagtggaataaattatataataaatgga
ttctgtagtttagggaatacttatatgcctttagagaagcttgtaagtgaggctatggac
atattaggggtaagagaagaagaaatacatgaaaatatatataataatatagcagaaaat
aaattaaagatagaaaaagtaaaagaacaaagttgtgtttttactctaccgtattattat
tgcgaattaggagttacaaaaaaaatacttagcttatctttgtcacaatatgataattta
aatataaatatagaagacgagatagtgagttttgaaaaaaataataatataaaatttcat
gattctcaaagagaggctataaaaggtgccttagaaaatggagtagaaataataacagga
ggccctggtacaggaaaaacaactattatcaattgtataacagagatatttgaaaaagct
aatatgaaagtttatatggcagcacctacaggaagagcggctaaaagaatgtctgaaact
acaggtagagaagctaaaacaatacataggatgttagaaatgggtgtatctgaggatgac
acagaagaagttttttctaaaggtgaagaaactcctttagaatgtgatgtagtaataata
gatgaagcctccatgatagatataatattaatgaatacactgttaaaggccatagcttta
ggtacaagaataataatagttggggatgtagatcaacttccctcagtaggtccagggaat
gtattaagagatttaatagaaagtaagtgtgtaaaggtagttagattaaaggagatattc
agacaatctaaagaaagtatgattatagtaaatgcccatagaataaatgatggagagatg
ccaattataaataaaaaagataaagatttttattttatagaatgtagtgaacctaaaaaa
atagttaatacattattagaactttcaaatagaagattgcctaaatttaataaaagttgg
cataaaattcatgatatacaaatactatctccaatgagaaagggagttctaggagtttct
agtttaaataaggaattacaatctgttttaaaccctaaaaatgattcaaaaaaagaaatg
gaatttaaggattatatatttagagtaggagataaagttatgcaaaccaaaaataactac
tctttaaagtggaccagagcaagtggtgagggggaagcagaagggttaggaatatttaat
ggagatgtaggatatatagaggatatagatgaggaaaaagaaacaattcaggtcttattt
gataatgaaagaagagtaatatatgaaaatttatatttagatgaaatagatttagcttat
gctgtaactattcataaaagtcaaggtagcgaatttccagtagtaattatgccagctttt
aaaggtcccccacttttaatgaatagaaatttattgtatacaggaataacaagagcaaaa
aggcttgttgtcttggtaggatctttaaaatctattaattttatggtacagaatgataaa
atttttgaaagatactctcttttaaagtggcgtataagtaatattttagatactgaaatt
ataaatggagaataa

DBGET integrated database retrieval system