KEGG   Clostridium botulinum A2: CLM_0413Help
Entry
CLM_0413          CDS       T00883                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cby  Clostridium botulinum A2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CLM_0413 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_0413 (adhE)
   00620 Pyruvate metabolism
    CLM_0413 (adhE)
   00650 Butanoate metabolism
    CLM_0413 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CLM_0413 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CLM_0413 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLM_0413 (adhE)
   00626 Naphthalene degradation
    CLM_0413 (adhE)
Enzymes [BR:cby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CLM_0413 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLM_0413 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434540..437128
Genome map
AA seq 862 aa AA seqDB search
MKITTTEELIRKIEKIKEAQKIYSTYSQDKVDKIFKAAAIAANKERIKLAKMAVEETGMG
IVEDKVIKNHFASEYIYNKYKDEKTCGVIEKDEAFGLTKIAEPIGVIAAIVPTTNPTSTA
IFKALIALKTRNGIIFSPHPRAKKSTIMAAKIVLDAAVQAGAPKEIIGWIDEPTLELSNA
VMSNSNLVLATGGPGMVKAAYSSGKPAIGVGPGNVPAIIYETADIKMAVSSVVLSKTFDN
GMICASEQSVIVMNSIYEEVKKEFVIRGAYVLNKEEIEKVKKIILVNGNVNAKIVGQTPQ
KIGEMAGVKVPDWAKLLVGEVQSVELEEPFSHEKLSPVLAMYKVKTYEEALTKAERLVEL
GGFGHTSSLYINTVKCKEEVEKFSNNMKTGRTIINMPSAQGGIGDIYNFKLAPSLTLGCG
SWGGNSVSENVGPKHLLNIKNVAERRENMLWFRVPEKVYFKYGCLPIALKELKRMNKKKA
FIVTDKVLYELGVAKKATDVLDEIGINYKVFFDVAPDPTLETAKKGAKEMVDFNPDTIIA
IGGGSAMDAAKIMWVMYEHPEAEFEDLAMRFMDIRKRVYEFPHMGDKAMMISVATSAGTG
SEVTPFAVITDEKTGVKYPLADYELTPDMAIVDADLMLNMPKGLTAASGIDALTHAVEAY
VSVMASEYTDGLCLEAIKTIFEYLPKAYKEGAQDIEAREKMAHASTIAGMAFANAFLGVC
HSMAHKLGSMHHVPHGIANALLINETIKFNSEDMPRKQTAFPQYKYPNAKAKYANIADYL
SLGGKTPEEKVELLIKAIDKLKAEVNIPTSIEEAGISKDKFFKTLDEMSEQAFDDQCTGA
NPRYPLISEIKQMYTNVFSTKK
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccactactgaggaactaataagaaaaattgaaaaaatcaaagaggcacaa
aagatttattccacatattctcaagataaggtagacaaaatatttaaagcagcagctata
gcagctaacaaagaaagaataaaacttgcaaaaatggcagtagaagaaactggcatgggt
attgtagaagataaagttataaaaaatcattttgcatctgaatatatttataacaaatat
aaagatgaaaaaacctgtggtgtaatagaaaaggatgaagcctttgggttaacaaaaatt
gcagaaccaataggtgttattgcggcaatagttccaacaactaatccaacctcaacagct
attttcaaagctttaatagctttaaaaactagaaatggtataattttttcacctcatcca
agagctaaaaaatctacaataatggcagctaagattgttttagatgcagcagtacaagca
ggggcaccaaaagaaataataggttggatagatgaacctaccttagaattgtctaatgca
gtaatgagtaattcaaatctagttcttgcaacaggtggaccaggtatggttaaagcggca
tactcttcaggaaagccagctataggagtaggacctggaaatgtaccagctataatatac
gaaacagcagatattaaaatggctgtaagctcagtggtactttctaaaacttttgataat
ggtatgatttgtgcatcagaacaatcagtaattgtgatgaatagcatatatgaagaagta
aaaaaagaatttgtaattagaggagcctatgtattaaataaagaagagatagaaaaagtt
aagaaaataattttagttaatggaaatgtaaatgctaaaattgttggtcaaacaccacaa
aagataggtgaaatggctggagtaaaagttccagattgggctaaacttttagttggagaa
gttcaatctgtagaattagaagaaccattctctcacgaaaaactatcaccagttttagca
atgtataaagttaaaacttatgaagaggctttaactaaagctgaaagattagtagaatta
ggaggatttggacatacatcttcattgtatataaacacagtaaaatgcaaagaagaagta
gaaaagttctcaaataatatgaaaacaggaagaacaattataaatatgccatcagcccaa
ggtggtataggtgatatatataactttaaattagcaccatctctaactcttggttgcgga
tcctggggtggaaactcagtatcagagaatgtaggaccaaaacacttattaaatatcaaa
aatgtagctgagaggagagagaatatgctttggtttagagtaccagaaaaagtttacttt
aaatacggatgtcttccaatagctttaaaagaattaaaaagaatgaataagaaaaaggca
tttatagttacagataaagtattatatgaattaggagttgctaaaaaagcaacagatgtg
ttagatgagataggaataaattataaggtattctttgatgtagcgccagatccaacttta
gaaacagcaaaaaaaggtgcaaaagaaatggtagattttaatcctgatacaataatagct
ataggcggaggatctgctatggatgctgctaaaataatgtgggtaatgtatgaacatcca
gaagcagaattcgaagatttagctatgagatttatggatataagaaaaagagtatatgag
ttcccacatatgggagataaagcaatgatgatatcagtagctacttcagcaggtactggt
tcagaagtaactccttttgctgttataactgatgaaaaaacaggtgtgaaatatccacta
gcagattatgaattaactccagatatggctatagtagatgcagatttaatgcttaatatg
ccaaagggattaactgctgcatcaggaattgatgcattaactcatgcagtagaagcttat
gtatcagttatggcatcagagtatacagatggactatgtttagaggctataaaaaccata
tttgaatatctaccaaaagcttataaagaaggagcccaagatatagaagcaagagaaaaa
atggctcatgcatcaactatagcaggtatggcttttgcaaatgccttcttaggagtatgc
cactctatggctcataaattaggatctatgcatcatgtaccacatggtatagctaatgct
ttattaataaatgaaacaattaaatttaattctgaggatatgccaagaaagcaaactgct
ttcccacaatataaatatccaaatgctaaggctaaatatgctaatatagcagattattta
tcattaggtggaaaaactccagaagaaaaagttgagctattaataaaagctatagataaa
ttaaaagcagaagtaaatattccaacctctatagaagaggcagggatatcaaaggataaa
ttctttaaaactttagatgagatgtccgaacaagcttttgatgatcaatgtacaggagct
aatccaagatacccattaataagtgaaataaaacaaatgtatactaatgtttttagtact
aaaaaatag

DBGET integrated database retrieval system