KEGG   Clostridium botulinum A2: CLM_0607Help
Entry
CLM_0607          CDS       T00883                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cby  Clostridium botulinum A2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cby01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cby00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cby00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cby00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:cby00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(658104..660110)
Genome map
AA seq 668 aa AA seqDB search
MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
ESFTHMLKNASGVIKRKIDDVFGTSLRECDKKNLATLIYYPEQKLDLIKKSEKNLEDWYK
ITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIETIID
IDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHHSIDIQWGNHDIVW
MGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCENFKPRTID
KNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMEERLLLDKINIKEGTLNLNEKI
YKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSNGSLYLKYNSN
LLYHGCIPLNEDGSLKEVTLCKETLKGKSLLDKLDRLAREAYFFKKDPESKLYGMDMMWY
LWCGPNSPLFGKKKMTTFERYFLDDKNTHKEQKNPYYKYRNDEKMCTMIFEEFELDADNS
HIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTLIYNSYGLLLTSHEP
FSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDLEMLLVAYRKGLIKE
ENEANIRF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgactttatatgatgagaacaacttacatataataaaagataatttaagatatttaaaa
ttattgtccaaacagtatcctagtatttcaagtgctagttcagaaattataaatcttcaa
gcaatattaaacctccctaagggaacagaacattttataagtgatgttcacggagagtat
gaatcttttactcatatgctaaaaaatgcatcaggagttattaaaagaaaaatagatgat
gtctttggaacctctttaagggaatgtgacaaaaaaaatttagctacactaatatactat
cctgaacaaaaattagatttaataaaaaaatctgaaaaaaacttagaagattggtacaaa
ataactttatatagattaataagactatgccaaatagtttcttctaaatatactagatct
aaagttagaaaatctctaccttctgattttgcttacattattgaagaattattaaatgaa
caaggtgatagagtagataagcaagaatattacaacagtataattgaaactattatagat
attgatagagcttctgaatttataattgctatatcaaatgttattcaaagattagtagta
gataagcttcatataataggagatatctatgatagaggtcctggagctgaaattataatc
gaagctttaagtaagcatcattctatagatatacaatggggtaatcatgacattgtatgg
atgggtgctgctgcgggatgtgaagcttgtattgccaatgtaataagaatatctcttcgt
tatgctaatttatccacattagaagatggatatggtataaatttattaccattagctacc
tttgctatggatttttataaagaagataattgtgaaaattttaaacctagaactatagat
aaaaatttaaacgaaacagatattaagcttttatcaaaaatgcataaagctatatcaata
attcaatttaagttggaaggtaaaataatcaaaagaagacctgaatttaaaatggaagaa
agattattattagataaaataaatataaaagaaggtactttgaacctaaacgagaaaatt
tataaattaattgatactaactttcctacattagataaagaaaatccttatgaattaaat
gaacgagaacgagatttagtagaaaaacttacaaattcgtttattaatagtgaaaagtta
caaagacatataaaatttttatatagtaatggaagtctttacttaaagtacaactctaat
ttactatatcatggttgtatacctttaaatgaggatggctccttaaaagaagtaactcta
tgcaaggaaaccttaaagggtaaatcccttctagacaaactagatcgtttagcaagagaa
gcttacttttttaagaaagatccagaatcaaaactatatggtatggacatgatgtggtat
ttatggtgtggtcctaattctcctttatttggtaaaaaaaagatgaccacctttgaaaga
tatttcttagatgataagaatacacataaagaacaaaaaaatccttattacaaatataga
aatgatgaaaaaatgtgcacaatgatatttgaagaatttgaactagatgctgataattcg
catataataaatggtcatattcctgtgaaaactaaagaaggcgaaaatcctataaaagct
aatggtaaactattagttatagatggtggtttttgtaaagcctatcagccacaaacgggt
attgcaggatatacattaatatataattcctatggattacttctaacctctcatgagcct
tttagttctatacacaaagctatagtagaaggaaatgatatactttcatctactacaata
ttagaacatgtatcctcacgaaaaagagtattagatacagatagtggtgaggagataaaa
aaacagatacatgatttagaaatgctattagttgcttacagaaaaggtcttataaaagaa
gaaaatgaagcaaatataagattttag

DBGET integrated database retrieval system