KEGG   Clostridium botulinum A2: CLM_0807Help
Entry
CLM_0807          CDS       T00883                                 

Gene name
nifH
Definition
nitrogenase iron protein (EC:1.18.6.1)
Orthology
K02588  
nitrogenase iron protein NifH [EC:1.18.6.1]
Organism
cby  Clostridium botulinum A2
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:cby00910]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:cby00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
869606..870355
Genome map
AA seq 249 aa AA seqDB search
MKKIAIYGKGGIGKSTTVSNVSAAMAEMGLTVMQIGCDPKADSTRNLTGGKNIPTVLDTL
REKGDIELDDLVFKSSTGVLCVESGGPVPGVGCAGRGIITAFEKLEELDAYEVYKPDVIL
YDVLGDVVCGGFAMPIRGGYADEVCIVTSGEMMSLYAATNIAHAVKSFGKRGYASLRGLI
LNSKKIENEQELVRKVAEEIETPVIHSMERDPYVQKAEALGKTVVEAFPECDMAKHYGTL
AKILLEGGK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgctatttatgggaaagggggcattggaaagtccactacggtatccaat
gtatctgcagctatggcagaaatggggcttacagtaatgcaaattgggtgtgaccctaag
gcggactctactcgaaatctaaccggcggtaaaaatattcccacggtattggatactcta
agagaaaagggagatatagagctagatgaccttgtatttaaaagtagtactggtgtcttg
tgtgtagaatcaggaggaccagttccaggagtaggctgtgccggccgtggaataatcact
gcatttgaaaaactggaagaattagatgcatatgaagtatataaaccagatgttatcctc
tatgatgtattgggtgatgtggtatgcggtggatttgctatgcctattagaggaggatat
gccgatgaggtgtgtatagttacatcaggggaaatgatgtcgctttacgcagctacaaat
attgcacatgctgttaaaagttttggtaagcgtggatatgcatccctacgaggattgata
ctaaactctaaaaaaatcgaaaatgaacaagagttagttagaaaagttgcagaggaaatt
gaaacaccagtaattcactctatggaacgagatccttatgtacagaaagctgaagcttta
ggaaaaactgtagttgaagccttcccagaatgtgatatggcaaagcactacggtactttg
gcaaagattctattagagggagggaagtga

DBGET integrated database retrieval system