KEGG   Clostridium botulinum A2: CLM_0970Help
Entry
CLM_0970          CDS       T00883                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cby  Clostridium botulinum A2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLM_0970 (folP)
Enzymes [BR:cby01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CLM_0970 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1031347..1032534
Genome map
AA seq 395 aa AA seqDB search
MIIELNKNSFPEEFNKIEVHEGSVNIFMNKNSITPLKIFNVLAPAANIIKQEILALGGDC
AVNKYCINCKVETSDIILLGTKRQYKKLLQKLKCMTFFRIEEIVGELENYINNHKKIKTV
LRDGREINYENLKVMGIINCTPDSFYEGSRKNSIEEALKTAEKMLKEGAEILDIGGESTR
PGSDPVDEEEEIKRVVPVIREIKNKFKDVIISIDTYRANTAKAAIEAGADIVNDISAMKY
DENMVKVVKEYNIPVILMHVKGKPKDMQIDPVYENLMKEIHLYFNERIEYCKSHGITEDK
IILDPGIGFGKTVEHNLKIMNRLEELKSFNLPVLLAASRKATIGKVLGNLSTEERLEGTI
ALSCLAVNSGLQMVRVHDVKENVRAIRMLEAVRKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgattatagaattaaataaaaatagtttcccagaagagttcaataagatagaagtacat
gagggtagtgtgaatatatttatgaataaaaatagtattacccctttaaaaatttttaat
gtgctagctcctgcggccaatataataaagcaagaaatactggctttaggtggagattgt
gctgtaaataaatattgtataaattgcaaagtggaaacttcagatataattttattagga
accaaaagacagtacaaaaaattattgcaaaagcttaaatgcatgactttttttagaata
gaagaaatagtaggggaattagaaaattatattaacaatcataaaaaaattaaaacggtt
ttaagagatggaagagaaataaactatgagaatttaaaggttatgggaattataaattgt
actccagattctttttatgagggctctagaaaaaattctatagaagaagctttaaaaact
gcagaaaagatgttaaaagaaggggcagaaattttagatataggtggagaatccacaaga
ccaggttctgacccagtagatgaagaggaagaaataaaaagagtagttcctgttataaga
gagataaagaataaatttaaggatgtcataatttccatagatacttatagagcaaatacg
gcaaaggctgccatagaggcaggtgcagacatagtaaatgatataagtgctatgaagtat
gatgaaaatatggtgaaagtagttaaagaatacaatatacctgtaatacttatgcatgta
aaaggaaaaccaaaggatatgcaaatagatccagtttatgagaatttaatgaaagaaatt
catctttattttaatgagagaatagagtactgcaaatctcatggcataacagaggataaa
ataatattagatccaggcataggttttggaaaaactgtagagcataatctaaaaataatg
aacagattagaagaattgaaaagctttaatcttccagtacttttagcagcctcaagaaaa
gccacaataggaaaagttttaggaaacttatctacagaagaaagattagaaggaactata
gctttatcctgtttagctgtaaattcaggacttcaaatggtgagagtacacgatgttaaa
gaaaatgtaagagccataagaatgttagaggcagtaagaaaaatataa

DBGET integrated database retrieval system