KEGG   Clostridium botulinum A2: CLM_0973Help
Entry
CLM_0973          CDS       T00883                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cby  Clostridium botulinum A2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLM_0973 (folK)
Enzymes [BR:cby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CLM_0973 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1033039..1033494
Genome map
AA seq 151 aa AA seqDB search
MHTAYVAFGSNMGEKENYIKRALEKIEERGMKIIKVSSIYETEPYGVLDQDSFLNGVVKI
ETNLTPEDLIGELLNIEKQLDRVRERRWGPRTIDLDIIFYDDLIINEKDLVIPHKDMENR
EFVLKPLCDIDENFIHPVLKKSVRQLYDELK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcatacagcttatgtggcctttggtagtaatatgggtgaaaaagaaaattacataaaa
agggcattggaaaagatagaagaaagaggaatgaaaataattaaagtgtcctctatatat
gaaacagaaccctatggagtattagatcaagatagttttttaaatggagtagtaaaaata
gaaactaatttaactccagaagatttaataggggagcttttaaacatagaaaaacagtta
gatagagtaagagaaagaagatggggacctagaactatagatttagatattattttttat
gatgatttaataataaatgaaaaagatttagttattcctcataaggatatggaaaacaga
gagtttgtactaaaacctttgtgcgatatagatgaaaattttatacatccggttttaaaa
aaatcagtaagacaattatatgatgagttgaagtaa

DBGET integrated database retrieval system