KEGG   Clostridium botulinum A2: CLM_1021Help
Entry
CLM_1021          CDS       T00883                                 

Definition
glycosyl hydrolase, family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cby  Clostridium botulinum A2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_1021
Enzymes [BR:cby01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CLM_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1077200..1078621
Genome map
AA seq 473 aa AA seqDB search
MSGLAKDFLWGGATAANQCEGGYLEGNRGLGTVDVIPAGVNRRAVMQGKMHYNNLQEDSY
FPSHEAIDMYHSYKEDIALFAEMGFKCYRFSLSWSRIFPTGKEQEPNEEGLAFYEKFIDE
LLKYNIEPVVTICHFDVPLVLEQEYGSWRSRKLIDAYLRYCEAIFKRFNGKVKYWITFNE
INMLMHLPFMGAGIMFKEGEIELEVKYQAAHNELVASALATKLAKEINKDNKVGCMLAAG
QFYPYTCKPEDVLEAMEKDKNNYFFIDVQSRGEYPSYAKKFLERNNIKIEMQSEDEKILR
ENTVDFIAFSYYTSRLASSDPNAGEKSAGNVITSLKNPHLKSSKWGWQIDPIGLRITMNS
LYDRYQKPLFIVENGLGAVDILNEDGTVDDDYRIAYLETHIKNMIDAVELDGVELLGYTT
WGCIDLVSASTGEMKKRYGFIYVDKDNDGHGTLKRYKKKSFYWYKNVIKNNGL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattagcaaaggactttttatggggtggagctacagcagctaaccagtgcgaa
ggtggatatttagaaggaaatagaggattaggaactgtggacgttattccagcaggagta
aatcgtagagctgttatgcaaggaaagatgcattataataatctacaagaggattcttat
ttcccatcacatgaagcaatagatatgtatcatagctacaaggaggatatagcattattt
gcagaaatgggatttaaatgttatcgtttttcactttcatggtcaagaattttcccaaca
ggaaaggaacaagaaccaaatgaagaaggcttagcattttatgaaaaatttattgatgag
ctattaaaatataatattgaaccagtagttaccatatgccattttgatgtacctcttgta
ttggagcaggaatatggttcatggagaagtagaaaattaatagatgcatatcttagatat
tgtgaagcaatatttaaaagatttaatgggaaagtaaagtattggataacttttaatgaa
ataaatatgcttatgcatttaccctttatgggagctggaataatgtttaaggaaggggaa
attgagctagaagtaaaatatcaagcagctcataatgaattagtggcatcagccttagct
acaaaattagcaaaggaaattaataaagataataaagtaggatgtatgttagcggcaggg
caattctatccatatacttgtaagccagaagatgttctagaagctatggagaaagataaa
aataattatttcttcatagatgtacaatctaggggagaatacccgagctatgctaaaaaa
ttcttagagagaaacaatataaaaatagaaatgcagtcagaagatgagaagattttaagg
gagaatactgttgattttattgcatttagttactatacttcaagacttgcaagtagtgac
ccgaatgcaggagaaaaatcagctggtaatgtaataacatcattaaaaaatccacattta
aaatctagtaaatggggatggcaaatagatccaataggccttagaattacaatgaattca
ctttatgatcgttatcaaaaaccgctattcattgtggaaaatggcttaggtgctgttgat
attttaaatgaggatgggactgtagatgatgattatagaattgcttatcttgaaactcat
ataaaaaatatgattgatgcagttgaattagatggtgttgaactattaggatatacaact
tggggatgcattgatttagttagtgcatcaacaggggaaatgaaaaagcgatatggtttt
atatatgtagataaggataatgatggtcatggaactttaaagagatacaagaaaaaatct
ttctattggtacaaaaatgttattaaaaataatggactataa

  All links  
No link information was found.   
DBGET integrated database retrieval system