KEGG   Clostridium botulinum A2: CLM_1069Help
Entry
CLM_1069          CDS       T00883                                 

Definition
uroporphyrinogen III synthase/methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cby  Clostridium botulinum A2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLM_1069
Enzymes [BR:cby01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CLM_1069
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLM_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1118803..1120263
Genome map
AA seq 486 aa AA seqDB search
MSKVYLIGAGPGDEELITLKAIRALKKCTAVMYDRLANGELLKYLAPNCEIYYCGKEPGC
HYKSQDEINKMLVKLAKEGHIVGRIKGGDPYVFGRGGEEALDILEENIEFEVIPGVTSPV
SVLNYAGIPITHRGISRGFHIFTAMTKDKLDIDWKSVVNIGGTLVFLMGLGRLELITKGL
IENGMDKEGKVAVVMKGTTSKQKKVIGNLENIVEKVKEAKLESPVIIVVGEVVSFSDKLN
WYEKKPLFGRNICITRTKEQAKELKVQLLDLGAEVTEINSIEIKNAEENLKPYLNRLKEY
DYIALTSVNAVKIFFDYLIKENIDIRNINAKFAAIGPATSEAIKVRGIMPSIKSKHFVAE
SLFEEMKKHVQSGDKVLVPRSKDARPFLVDALKKEGCIVDEVHIYETLCGQSSHTERFED
ADTVLFTSPSTVKNMISMVGIDSIKEKSIIAIGPITAAELYKNNIECSICDEYSINGIID
KLLDLN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtatatttaattggtgcagggccaggtgatgaagaattaataactttaaaa
gccataagagccctaaaaaaatgtactgcagttatgtatgatagattagcaaatggagaa
ttgttaaaatatttagcaccaaattgtgaaatttattattgtggaaaagaaccgggctgt
cattataaaagccaggatgaaataaataaaatgctagttaaattagcaaaagaaggtcat
attgtaggaagaataaaaggtggagatccctatgtatttggaagagggggagaagaagcc
ttggatattttagaagaaaatatagaatttgaggttataccaggtgtaacttctccagta
tctgtactgaattatgcaggaattcctataacccatagaggaatatcaagagggtttcat
atttttacagccatgactaaggataaattagatatagattggaagtctgtagttaatata
ggaggaaccttagtatttttaatggggcttggaagattagaattaataactaaaggtctt
atagaaaatggaatggacaaagaaggtaaagtagcagtggttatgaaaggaactacctca
aagcaaaaaaaagttataggtaacttagaaaatatagtagaaaaagtaaaagaagctaaa
ctagagtcaccagtaataatagtagtaggagaagtagttagtttttcagataaattaaat
tggtatgaaaaaaagcctttattcggaagaaatatatgcataacccgtacaaaagagcaa
gctaaggagttaaaagttcaacttttagatttaggggctgaagtcacagaaataaattct
atagaaataaaaaatgcagaggagaacttaaagccttatttaaatagattaaaagaatat
gattatatagctttgactagtgtaaatgcagttaaaatattttttgattatttaattaaa
gaaaatatagatattagaaatattaatgctaaatttgcagctataggaccagctactagt
gaagcaataaaagtgcgaggaataatgccaagtataaaatcaaagcattttgtagctgaa
agcctttttgaagaaatgaaaaagcatgttcaaagtggggataaggtacttgtacctcgc
tcaaaagatgcaaggccctttcttgtagatgcattaaaaaaagaaggttgcattgtagat
gaagtacatatatatgaaactttatgtggacaatcttctcatactgaaagatttgaagat
gcagatacagtattatttacaagtccatcaactgttaaaaatatgatttccatggtgggg
atagatagtataaaagaaaaaagtattatagcaataggtcctattacagcagcagaatta
tataaaaataatatagaatgtagtatttgtgatgaatattctataaatggcataatagat
aaacttttagaccttaactag

DBGET integrated database retrieval system