KEGG   Clostridium botulinum A2: CLM_1071Help
Entry
CLM_1071          CDS       T00883                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cby  Clostridium botulinum A2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cby00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1120852..1121826
Genome map
AA seq 324 aa AA seqDB search
MFRRHRRLRENEAIRAMVRETVIREEDFIYPMFVVEGENIKEEISSLPGNYHYSIDRLEE
LVEEVKKSGIKGIMIFGVPDHKDECGSAAFDDNGIVQKGIRRLRELMPELYIVADVCMCQ
YTSHGHCGIIHGHNVDNDESLKYLAKISLSYAKAGADMIAPSDMMDGRVYAIRKILDENN
FKHVGIMAYSAKYCSAFYGPFREAANSAPQFGDRKTYQMDPANGREAMLEIEDDINEGAD
IVMVKPALPYLDVIRMAKDRFEFPLAAYNVSGEYAMVKAAAKQGLIDERRVALEMLTSIK
RAGADIIITYYAFEASAWLKEDRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacacagaagattaagagaaaatgaagcaataagagctatggtaagagaa
acagtgattagagaagaggattttatatatccaatgtttgtggtagaaggagaaaatatt
aaagaagaaatatcttcactaccaggaaattatcattattctatagatagattagaagaa
ttagtagaggaagtaaaaaaatcaggaataaaaggtataatgatatttggagtaccagat
cataaagatgaatgtggttccgcagcctttgatgataatggaatagttcaaaagggtata
agaagattaagagaattaatgccagaactatatatagttgcagatgtatgtatgtgccaa
tatacaagtcatggacattgcggaataattcatggtcataatgtagataatgatgaatca
ttgaaatatttagcaaaaatatctttatcctatgcaaaagctggagcagatatgatagcc
ccttcagatatgatggatggaagagtttatgctataagaaaaatattagatgaaaataat
tttaaacatgtaggcataatggcttatagtgcaaaatattgttcagctttctatggccct
ttcagagaagcagctaattcagcaccacaatttggagacagaaaaacttatcaaatggat
ccagcaaacggaagagaagcaatgcttgaaatagaagacgatataaatgaaggtgcagat
atagtaatggtaaaaccagctctgccatacttagatgttataagaatggcaaaggataga
tttgaattcccgttagcagcttacaatgtaagtggagaatatgctatggtaaaagcagca
gctaaacaaggattaatagacgaaagaagagtagccctagaaatgctaacatcaataaaa
agagcaggagcagatataataataacttattatgcatttgaagcaagtgcttggctaaaa
gaagacagaaaatag

DBGET integrated database retrieval system