KEGG   Clostridium botulinum A2: CLM_1127Help
Entry
CLM_1127          CDS       T00883                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cby  Clostridium botulinum A2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLM_1127
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLM_1127
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLM_1127
Enzymes [BR:cby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLM_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1165793..1166911
Genome map
AA seq 372 aa AA seqDB search
MIERNKSIKNLYCIRCNKKYGISDYFRGCEKCLNDGLPASVTFHYEVGESVNNINEVFPY
SMQSMLGEGNTPIISHKKISDIYGIESFYLKNEFQNPTGSHKDRMSPYIVARAIEMKRKG
VVVASSGNAGISIASYASYKGVKSIVVTTKGINPVYKRAIEATGAQIIITETSDERWNIV
KKLVDIEGWYPATNYINPPVGSNPFGVQGYKKIAFEIYEFFNEKLPTHILIPVSRGDLLW
GVYEGFKNLLQLGYIIEIPKLIAVEPIPRIESVLKGKSYIKKFKGDYSKTPSIGGDTVTY
QSIKAIKETNGCAITVNAEKIPSALKLIGSSGVYLETSSALAIQGLCILREKEIINENSR
VLMIATSHGYKN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattgagagaaataaatccataaaaaatttgtattgtattaggtgcaataaaaagtat
ggaatatcagattattttagggggtgtgaaaaatgtttaaatgatggactaccagcaagt
gtaacatttcattatgaagtaggggaaagtgttaataatataaatgaggtgtttccctat
tcaatgcaatcaatgttaggtgaaggtaatactccaataattagtcataaaaaaatcagt
gatatatatggaattgaaagtttttatttgaaaaacgaatttcaaaatccaacaggatca
cataaggatagaatgagtccttatattgttgctagggcaatagagatgaaaagaaaaggg
gtggtagtagcctcaagtggaaatgcaggtatttctatagcatcttatgctagttataaa
ggggtgaaatctatagtagttactactaagggaataaacccagtttataagagagctatt
gaagctactggtgcacaaattataattaccgaaacatcagatgaaagatggaacatagtt
aagaaattagtagatatagaagggtggtacccagcgacaaactatataaatccacctgtt
ggcagcaatccatttggagtacaaggctacaaaaaaatagcctttgagatatatgaattt
tttaatgaaaaactacccactcatatattaatcccggtttcaagaggagacttactatgg
ggagtatatgaaggcttcaaaaacttacttcaactaggttatattatcgaaataccaaaa
ttaattgcagttgaacctataccaagaattgaatctgttctaaaaggtaagagttatatc
aaaaaatttaaaggagattactcaaaaactccttctataggaggtgatactgttacatat
caatcaataaaggcgataaaagaaacgaatggatgtgcaataactgtaaatgcagagaaa
ataccttccgcattaaaattaattggaagtagtggtgtatacttagaaacatcttcagca
ctagcgattcagggactttgtattcttagagaaaaggaaattattaatgagaatagtcgt
gtacttatgattgccacttcacatggatataaaaactaa

DBGET integrated database retrieval system