KEGG   Clostridium botulinum A2: CLM_1127Help
Entry
CLM_1127          CDS       T00883                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cby  Clostridium botulinum A2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLM_1127
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLM_1127
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLM_1127
Enzymes [BR:cby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLM_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1165793..1166911
Genome map
AA seq 372 aa AA seqDB search
MIERNKSIKNLYCIRCNKKYGISDYFRGCEKCLNDGLPASVTFHYEVGESVNNINEVFPY
SMQSMLGEGNTPIISHKKISDIYGIESFYLKNEFQNPTGSHKDRMSPYIVARAIEMKRKG
VVVASSGNAGISIASYASYKGVKSIVVTTKGINPVYKRAIEATGAQIIITETSDERWNIV
KKLVDIEGWYPATNYINPPVGSNPFGVQGYKKIAFEIYEFFNEKLPTHILIPVSRGDLLW
GVYEGFKNLLQLGYIIEIPKLIAVEPIPRIESVLKGKSYIKKFKGDYSKTPSIGGDTVTY
QSIKAIKETNGCAITVNAEKIPSALKLIGSSGVYLETSSALAIQGLCILREKEIINENSR
VLMIATSHGYKN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattgagagaaataaatccataaaaaatttgtattgtattaggtgcaataaaaagtat
ggaatatcagattattttagggggtgtgaaaaatgtttaaatgatggactaccagcaagt
gtaacatttcattatgaagtaggggaaagtgttaataatataaatgaggtgtttccctat
tcaatgcaatcaatgttaggtgaaggtaatactccaataattagtcataaaaaaatcagt
gatatatatggaattgaaagtttttatttgaaaaacgaatttcaaaatccaacaggatca
cataaggatagaatgagtccttatattgttgctagggcaatagagatgaaaagaaaaggg
gtggtagtagcctcaagtggaaatgcaggtatttctatagcatcttatgctagttataaa
ggggtgaaatctatagtagttactactaagggaataaacccagtttataagagagctatt
gaagctactggtgcacaaattataattaccgaaacatcagatgaaagatggaacatagtt
aagaaattagtagatatagaagggtggtacccagcgacaaactatataaatccacctgtt
ggcagcaatccatttggagtacaaggctacaaaaaaatagcctttgagatatatgaattt
tttaatgaaaaactacccactcatatattaatcccggtttcaagaggagacttactatgg
ggagtatatgaaggcttcaaaaacttacttcaactaggttatattatcgaaataccaaaa
ttaattgcagttgaacctataccaagaattgaatctgttctaaaaggtaagagttatatc
aaaaaatttaaaggagattactcaaaaactccttctataggaggtgatactgttacatat
caatcaataaaggcgataaaagaaacgaatggatgtgcaataactgtaaatgcagagaaa
ataccttccgcattaaaattaattggaagtagtggtgtatacttagaaacatcttcagca
ctagcgattcagggactttgtattcttagagaaaaggaaattattaatgagaatagtcgt
gtacttatgattgccacttcacatggatataaaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system