KEGG   Clostridium botulinum A2: CLM_1290Help
Entry
CLM_1290          CDS       T00883                                 

Definition
pncA family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cby  Clostridium botulinum A2
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CLM_1290
Enzymes [BR:cby01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CLM_1290
    3.5.1.-  
     CLM_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1350318..1350878
Genome map
AA seq 186 aa AA seqDB search
MFKSILIIDCQNDFISGSLACDNGEIAVKNIINLLNINKDLKVFYSLDWHSENNKSFRIN
GGIWPVHCVANRFGAKLEESFYKELQHKNHSPNNKKILFLKGKNDYIEEYSAYEGENILG
NKINEVLDKDVIVCGIASEFCVKETVEDLIRNGFNVELYIDGVAYVNKKEHEKTLNNLRE
QGVKFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatcaatacttataatagattgccaaaatgatttcatatcaggttcactggct
tgtgataatggagagatagctgttaaaaatattataaatttattaaatataaataaagat
ttaaaagtattttattctttagattggcatagtgaaaataataaatcttttagaataaat
ggtggtatatggccagtacattgtgtagccaatagatttggtgctaaattagaggagagt
ttttataaagaattacaacataaaaatcattcacctaataataaaaaaatattgttttta
aaaggaaaaaatgattatatagaagaatattcagcctatgaaggagaaaatattttaggt
aataagattaatgaagtattagataaggatgtaattgtatgtggtatagcttctgagttt
tgtgttaaagaaacggtagaggacttaattagaaatggatttaatgtggaattatatata
gatggggtagcatatgtaaataaaaaagaacatgaaaaaactttaaataatttaagagag
cagggggttaaatttatttaa

DBGET integrated database retrieval system