KEGG   Clostridium botulinum A2: CLM_1353Help
Entry
CLM_1353          CDS       T00883                                 

Definition
O-glycosyl hydrolase, family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cby  Clostridium botulinum A2
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1415549..1416877
Genome map
AA seq 442 aa AA seqDB search
MKFIQYKTTKKDKFLKNEINNTTDERPTLHVSQIENRIIEGFGSCFNELGMKALNHLDKD
ERNKVFDQLFSIKGDCRFNLCRMPIGASDYATEWYSYNENENDFDMEKFSIQKDKRLLIP
YIKEALKRNPNIILTASPWSPPTWMKTQKAYNFGTLRFEEKVLKAYALYFVKFVQAYEEE
GITIHQVHVQNEVVADQKFPSCRWTGDQLRDFIKNYLGPAFEKHNIKSEIWLGTINAPEP
YVEWLEDYTQDFDVYAGLVLRDPKAYKYVKGVGYQWAGKNAIQRSVEAFPEKRFIQTENE
CGNGKNTWIYAEYVFNLFRHYIVNGVNGYMYWNAVLEPKGMSTWGWEQNSMITVNPETKE
VMYNPEFYVMKHFSHFVQKGAKRLTTSGVDSVDTVAFKNPDESIIIVISNKNDDSRIANI
EFTGEIFEVELEGHSFNTIVLE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatacagtataaaactactaaaaaagataaattcttaaaaaacgaaattaat
aatactacagatgaaagaccaacattacatgtttcacaaattgaaaataggatcatagag
ggatttggaagttgttttaatgagctggggatgaaagcattaaatcacttagacaaagat
gaaagaaataaagtatttgatcaactattttctattaaaggtgattgtcgttttaatctt
tgcagaatgcctattggagcaagtgattatgcaacagaatggtatagctataacgaaaat
gaaaacgattttgatatggagaaatttagtattcaaaaagataaaagacttcttatacct
tatataaaggaagcattaaaaagaaatcctaatataattctaacagcttctccatggagt
cctccaacttggatgaaaacacagaaggcttacaattttgggactctacgctttgaagag
aaagttttaaaagcatatgctctttattttgttaaatttgtacaagcatatgaggaagaa
ggaataacaattcatcaagttcatgttcagaatgaagttgttgcagatcaaaaatttccg
tcttgtagatggacaggagatcaattaagggattttattaaaaattatttaggaccagcc
tttgaaaagcataatattaagagtgaaatttggttagggacaattaatgcgccagagccc
tatgttgaatggctagaagattatacacaagattttgatgtttatgctggcttagtattg
agagatccaaaagcatataagtatgttaaaggagtaggatatcaatgggcaggaaaaaat
gctattcagcgttcagttgaagcatttccagaaaaaagatttatccaaactgaaaatgag
tgcggtaatggtaaaaatacatggatatatgcagaatatgtttttaatctattcagacat
tatattgtaaatggtgtaaatggatatatgtattggaatgctgttttagaaccaaaagga
atgagtacttggggatgggaacagaattctatgataactgtaaatccagaaactaaagaa
gttatgtataatccagagttctatgtaatgaaacatttttctcattttgttcaaaaaggg
gcaaaaagattaactacttcaggtgtagattctgttgatacagtagctttcaagaatcca
gatgaatctataattattgtaatttcaaataaaaatgatgattctagaattgctaatatt
gaatttacaggtgaaatatttgaagttgaattagaaggacattcatttaacactattgtt
ttagaataa

DBGET integrated database retrieval system