KEGG   Clostridium botulinum A2: CLM_1355Help
Entry
CLM_1355          CDS       T00883                                 

Definition
putative beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cby  Clostridium botulinum A2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_1355
Enzymes [BR:cby01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CLM_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1417885..1419330
Genome map
AA seq 481 aa AA seqDB search
MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGDEKEANEKGLQFYDDVFDECLKYGIQP
IVTLSHYETPLHLSKAYDGWKCREMIGFFNKYVCTVFNRYKNKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIHRAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWETLNKERENFFFSDIQVRGYYPSYSKRFFKENNIKLDITNKDIEILKNTVDFISF
SYYMSICESSDKSIRAGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELGDGTKTVLDDYRISYLRDHLIQVSEAIEDGVDLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDGTGTLERYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaattttccagaaaattttttgtggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatgtagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatggggtttaaggttttt
aggttatcaattgcgtggtcaagaatattcccaatgggggatgaaaaagaagcaaacgag
aagggactacaattttatgatgatgtttttgatgagtgcttaaagtatggcatacagcca
atagtaacattgtcccattatgaaacaccattgcatttatctaaagcgtatgatggatgg
aaatgtcgtgagatgattggattttttaataagtatgtttgtacagtttttaatcgatat
aaaaataaagtaaaatattggttaacttttaatgaaattaattcaattactcatgcgcca
tttttaagtggcggaatttatacaccaatagaaaaattaagtaagcaagaaattcatcga
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcgtgtcatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggagactcttaataaagaaagagagaattttttcttttcagatatt
caagttcgcggttattatccctcatattcaaaaagattctttaaagaaaataatattaaa
ttagatattacaaataaagatatagaaatattaaaaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagtgataaatctattagggcaggtgaaggaaat
attattggagggatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattatatgatcgttatcaaaagccattattt
atagttgaaaatggattaggagctgtagatgaattagttgagttaggagatggaacaaaa
acagtattagatgattatagaatttcatatttaagagatcatttaattcaagtatcagaa
gcaatcgaggatggagtggacttaatgggatatacttcttgggggtgcattgatctggtt
agttttaccacttctgaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatgggacagggacattagaacgttataagaaaaaaagcttttactggtataaagaagta
atttcaagtaatggagatattgaagcactatgctcaaatattagtattgaaaaagataaa
atataa

DBGET integrated database retrieval system