KEGG   Clostridium botulinum A2: CLM_1429Help
Entry
CLM_1429          CDS       T00883                                 

Definition
aldolase, class II, AraD/FucA subfamily
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cby  Clostridium botulinum A2
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cby00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1483790..1484437
Genome map
AA seq 215 aa AA seqDB search
MNNETYLRLQIVEVGKRLQQRFFVASNDGNISAKLDENTILITPTGVNKGEVTPDQIIKV
DREGNVIEGHMKVTSEIKMHLAVYNMREDVKAIVHAHPPASTAFSVSKEKLDDPVILPEA
VFSLGKIGYCEYGTPSTDEVPKAVEKEIPYSDVLLLSNHGALTVGTDVMQAYYRMENLEM
VSKVTIYSKMIGNIKTLNELQVEKLNKVKEEKGWG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgaaacgtatttaaggttacaaattgtagaagtaggaaaaagacttcaacaa
agattttttgtagcttcaaatgatggaaatataagtgctaaacttgatgaaaatactata
ttgattacgcctacaggcgttaataaaggagaagtaactccagatcaaataataaaagta
gatagagaaggaaatgttatagaaggtcatatgaaagttacatctgaaataaaaatgcat
ttagctgtttataatatgagagaagatgtaaaagctatagttcatgcccatccaccagca
tccacagctttttcagtatcaaaagaaaaactagatgatcctgttattcttccagaagca
gttttttcattagggaaaataggatattgtgaatatggaactccttctactgatgaggtt
ccaaaagctgtagaaaaagaaattccatatagtgatgtacttttattatctaaccatgga
gctcttacagtaggtacagatgtaatgcaggcttattacagaatggaaaatttagaaatg
gtttcaaaggtaactatttattcaaaaatgataggaaatataaaaactttaaatgaacta
caagttgagaaattaaataaagtaaaagaagaaaaaggttgggggtaa

DBGET integrated database retrieval system