KEGG   Clostridium botulinum A2: CLM_1694Help
Entry
CLM_1694          CDS       T00883                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cby  Clostridium botulinum A2
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cby00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cby00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1730453..1731904
Genome map
AA seq 483 aa AA seqDB search
MNLNLILKSLEYSFIKENKKEIEKIEYDSRKVKEGDLFVCIEGYATDGHKYAKKAYDNGA
KVIVCEKDLEDLSYYKDCTIIKVSDSRKALAIMSSNYYGNPSKHIKIIGITGTNGKTTST
FMMKAILEKAGYKVGLLGTIANYIGNKKIESHRTTPESLELQKLFKDMVDEKVDYCVMEV
SSHSLYLDRVYGVEFKEAIFTNLTQDHLDFHKTFENYFNSKLILFKNAQNSVINIDDSYG
EKVLKKALGNKITYGVEKNCDLKAENLHMHSRGVEFDTIFKNEKETIALNIPGKYNIYNA
LGSIGACLLEGIPLKTIKEALEDMPSVPGRCEIVTKNYNLGYDVIVDYAHTPDGLENILN
TAREFTKGRLISVYGCGGDRDRTKRPIMGKVGSNLSDIAIITSDNPRTEDPKLIIKDVLE
GIERDNYIVVEGRRDAIRKAMEIAKENDVIVVAGKGHEDYQILKDKTIHFDEREVIEELI
KEI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaatttaatactaaagtcattagaatattcttttataaaagaaaataaaaag
gaaatagaaaagatagaatatgattcaagaaaagttaaagaaggagatttatttgtttgt
atagagggatatgcaacagatgggcataaatatgcgaaaaaagcttatgacaatggagct
aaagtaattgtttgtgagaaggatttagaagacttatcctattataaagattgtactata
ataaaggtttcagatagtagaaaagccttagctataatgtcatctaattattatggtaac
ccatctaaacatattaaaataataggtattacaggaacaaatggcaaaactacatctact
tttatgatgaaagctatactagaaaaagcaggctataaagttgggcttttgggaactata
gcaaattatataggaaataaaaaaatagaatctcatagaactactccagagtctctagaa
ctacaaaaattatttaaagatatggtggatgaaaaagtagattattgtgtaatggaagta
tcttctcattctttatatttagatagagtttatggagtagaatttaaagaggctatattt
acaaatttaacgcaggatcatttggacttccataaaacctttgaaaattattttaattcc
aaactaattttatttaaaaatgctcaaaattcagtgataaatatagatgatagttatgga
gaaaaagtattaaagaaagctttaggaaataaaataacctatggtgtagagaaaaattgt
gatttaaaagcggaaaatttacatatgcattctagaggagtagaatttgatactatattt
aaaaatgaaaaagaaactatagctttaaatataccaggtaaatataatatatataatgct
ttaggaagtattggagcttgtcttttggagggtattcctttaaaaactataaaagaagca
ttagaagatatgccatctgtaccaggaagatgtgaaattgtaactaaaaattataattta
ggttatgatgttatagtagattatgcccatactccagatggattagaaaatatattaaat
actgctcgagaatttacaaagggaagattaataagtgtatacggatgcggtggagataga
gatagaactaaaagaccaattatgggaaaagtggggtcaaatttaagtgatatagctata
ataacctcagataatccaagaacagaggatcctaaacttataataaaagatgtattagaa
ggtatagaaagagataactatatagtagttgaaggaagacgagatgccataagaaaagct
atggaaatagcaaaagaaaatgatgttatagtagtggcaggaaaaggccatgaagattat
caaatattaaaggataaaactattcactttgatgaaagagaagtaatagaagaactaata
aaagaaatataa

DBGET integrated database retrieval system