KEGG   Clostridium botulinum A2: CLM_1805Help
Entry
CLM_1805          CDS       T00883                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cby  Clostridium botulinum A2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLM_1805 (rbsK)
Enzymes [BR:cby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CLM_1805 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1836176..1837087
Genome map
AA seq 303 aa AA seqDB search
MDIAVIGSNMVDLISYIDRMPKEGETLEAPDFKMGFGGKGANQAVTAARLKSDVMMVSKV
GDDLFGQNTIKNFKNNGVNTDFVTVQKNQASGVAPIFVDRESKNSILIIKGANKNLSPTD
IDDASEELKKCSLIILQLEIELETVYYAIDFANKNNISVLLNPAPATKELDFNYVYKCDF
FVPNETELEILTNKSVNTIGEIKEAAHLIGDKGVKNVIVTMGSKGLLWINKDEEHFIKAR
KVDAVDTTGAGDGFIGCFAHYYVATKNILLALEKATAYAALSVTRYGTQTSYPTKEEFEE
FLK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagttattggttcaaatatggtagatttgataagttatattgatagaatg
cctaaagaaggtgagactttagaagcaccagattttaaaatgggatttgggggtaaggga
gcaaaccaggccgttacagctgcaagattaaaatcagatgttatgatggtaagtaaagtt
ggagatgatttatttggacaaaacactattaaaaattttaaaaacaatggtgtaaataca
gattttgtaactgttcaaaaaaatcaagctagtggagttgcacctatttttgttgataga
gaatctaaaaatagtattttaattattaaaggtgccaataaaaatttatctcctacagat
atagatgatgcaagtgaagaattgaaaaagtgttctttaattattttacaattggaaatt
gaattagaaactgtttattatgctatagattttgctaataagaataatatttctgtattg
ttaaatcctgcgcctgctacaaaagaacttgatttcaattatgtttataagtgcgatttt
tttgttccaaatgaaacagaattagagattttaacaaataaatctgtaaatacaatagga
gagataaaagaagctgctcatttaattggggataaaggtgttaaaaatgtaattgttaca
atgggcagtaaaggtttactgtggattaataaagatgaagaacattttataaaagcacgt
aaagttgatgccgtggataccactggtgctggtgatggatttattggatgttttgcacat
tattatgtagccacaaaaaacatattattagctcttgaaaaagcaacagcttatgcagca
cttagtgttacaagatatggtactcaaacttcttatcctacaaaggaggagtttgaagaa
tttttaaaataa

DBGET integrated database retrieval system