KEGG   Clostridium botulinum A2: CLM_1808Help
Entry
CLM_1808          CDS       T00883                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cby  Clostridium botulinum A2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cby01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cby00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1839552..1840856
Genome map
AA seq 434 aa AA seqDB search
MINIVKIGEDNKKQCINNLKSRSKKVQKDVITSVKKILEDINGNGDKALIKYTNKFDSKK
INLENIRVTSEEIKKAYELVDEKFIKAIKIAKENILFYHEKQKQRSWMVTKEDGIILGQQ
IRALETVGIYVPGGTAAYPSSVLMNTLPAKVAGVEKIVMITPPSKDGSVNPNILVAANIA
GVDEIYKAGGAQGIGALAYGTEIIPKVDKIVGPGNIYVAMAKRSVYGFVDIDMIAGPSEI
LIIADESSDPKFIAADFMSQAEHDVLASSMLVTTSKRLAEKVIKQLNIQIKNLSRKEIIR
TSIKDYGAIFVVDNLEEAIELANDISPEHLEVMTEDPFTILGQIKNAGSVFLGKYAPEPL
GDYMAGPNHVLPTSGSARFFSPLSVDDYIKKSSFTYYTKRALEKVKDVTVTMAETEGLTA
HANSIRVRFDNNNF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgataaatatagttaaaataggtgaagacaataaaaaacagtgcataaataatttgaaa
agcaggtcaaaaaaagtacaaaaggatgtaattacttctgtaaaaaaaatactagaggac
ataaacggaaatggggataaagcattaataaaatatactaataaatttgatagtaaaaaa
ataaatttagaaaatattagagttacttcagaagagataaaaaaggcttatgaattagtt
gatgaaaaatttataaaggctataaaaattgctaaagaaaatatattgttttatcatgag
aagcaaaaacaaagatcatggatggtaacaaaggaagatggaataattttaggtcagcaa
attagagctctagaaactgtaggtatatacgttccaggaggaacagcagcttatccttct
tcagtattaatgaacacccttccagctaaagtagcaggagtagaaaaaatagttatgata
actcctccttctaaggatgggagtgtaaatcctaatattttagtagctgctaatattgca
ggagttgatgaaatatacaaagcaggaggagcacaaggaataggagctttagcttatgga
acagaaatcataccaaaggtggataaaatagtaggtccaggtaatatatatgtggctatg
gccaaaagaagtgtttatggttttgtggatatagatatgatagcagggcctagtgaaatt
ttgattatagcagatgaaagttctgatcctaaatttatagcagcagattttatgtctcaa
gctgagcatgatgtattggcatcctcaatgttagttactacctctaagagattagctgaa
aaggtaataaagcaattaaatatacagataaaaaatctttcaaggaaagaaataatacgt
acatctattaaagattatggtgctatttttgtagtagataatttagaagaagctatagaa
cttgctaatgatatatccccagaacatttagaggttatgacagaagaccccttcactatt
ttaggacaaattaaaaatgcaggttctgtattcttaggtaaatatgctccagaaccatta
ggggattatatggcaggaccaaatcatgtattgcctactagcggaagtgcaagatttttt
tcacctctttcagtagatgattatattaagaaatcaagtttcacatattacaccaaaagg
gcattggaaaaagtaaaggatgttactgtaaccatggctgaaacagagggattaactgcc
catgcaaattccataagagtgagatttgataacaataatttttga

DBGET integrated database retrieval system