KEGG   Clostridium botulinum A2: CLM_1879Help
Entry
CLM_1879          CDS       T00883                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cby  Clostridium botulinum A2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLM_1879 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLM_1879 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLM_1879 (thrC)
Enzymes [BR:cby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLM_1879 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1921623..1923104
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKNVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELENMDYKELAFYIMKK
YFDDFNEEELKECIDRAYDSKFEDPLIATLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKASAKKINITKDIVILTATSGDTGKAALEGFDSVEGTKIVVFYPKDGVSEIQKRQMVTQ
EGKNTFVVGIEGNFDDAQSGVKEIFNDKDFNELLEEKGCMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGESINIVVPTGNFGNILAAFYAKNMGIPVEKLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSCLIKNLMTELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAIAKVYESSNYLIDTHTAVAYDVYEKYKNRTEDNRVTIIA
STASPFKFPKSINEVLNIGHKNASDFELINLFSDKLNLKLPKGLEGLEEREICHKGTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggagaaggaaagaatgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagaactagaaaacatggattataaagaattagcattttatattatgaaaaag
tactttgatgattttaatgaagaggaacttaaagaatgtatagatagagcctatgacagt
aagtttgaagatcctcttatagcgacattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggccttaagcatacttccacacctt
ttaaaagcttcagcaaaaaagattaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggatttgatagtgtagagggcacaaagata
gtagtgttttatcctaaggatggagtaagtgaaattcaaaaaagacaaatggttacacaa
gaggggaaaaatacttttgtagttggtatagaggggaatttcgatgatgctcaaagtgga
gttaaggaaatatttaatgataaagattttaatgaattattagaggaaaagggatgcatg
ttttcctctgctaattctataaatatagggagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagacaaaaaagtaggggaaggagaaagtataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtggaaaaattaatttgtgcatctaatgagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatccagtaacttggaaagatttttgtatgaaataagtggaaaagattcatgc
cttataaaaaatctcatgacagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcagatgaagatgatacacttaaa
gctattgcaaaagtctatgaaagttctaattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaatagaacagaagataatagggttactattatagca
tccactgcaagtccattcaaatttcctaaaagtataaatgaagtgttaaatataggacat
aagaatgcctcagattttgaacttattaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaagagaaatttgtcataagggcacttgtaaaaag
gatgaaatgaagaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system