KEGG   Clostridium botulinum A2: CLM_1879Help
Entry
CLM_1879          CDS       T00883                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cby  Clostridium botulinum A2
Pathway
cby00260  Glycine, serine and threonine metabolism
cby00750  Vitamin B6 metabolism
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01120  Microbial metabolism in diverse environments
cby01230  Biosynthesis of amino acids
Module
cby_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLM_1879 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLM_1879 (thrC)
Enzymes [BR:cby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLM_1879 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP MtrB_PioB
Motif
Other DBs
NCBI-ProteinID: ACO86105
UniProt: C1FNA4
Position
1921623..1923104
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKNVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELENMDYKELAFYIMKK
YFDDFNEEELKECIDRAYDSKFEDPLIATLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKASAKKINITKDIVILTATSGDTGKAALEGFDSVEGTKIVVFYPKDGVSEIQKRQMVTQ
EGKNTFVVGIEGNFDDAQSGVKEIFNDKDFNELLEEKGCMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGESINIVVPTGNFGNILAAFYAKNMGIPVEKLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSCLIKNLMTELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAIAKVYESSNYLIDTHTAVAYDVYEKYKNRTEDNRVTIIA
STASPFKFPKSINEVLNIGHKNASDFELINLFSDKLNLKLPKGLEGLEEREICHKGTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggagaaggaaagaatgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagaactagaaaacatggattataaagaattagcattttatattatgaaaaag
tactttgatgattttaatgaagaggaacttaaagaatgtatagatagagcctatgacagt
aagtttgaagatcctcttatagcgacattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggccttaagcatacttccacacctt
ttaaaagcttcagcaaaaaagattaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggatttgatagtgtagagggcacaaagata
gtagtgttttatcctaaggatggagtaagtgaaattcaaaaaagacaaatggttacacaa
gaggggaaaaatacttttgtagttggtatagaggggaatttcgatgatgctcaaagtgga
gttaaggaaatatttaatgataaagattttaatgaattattagaggaaaagggatgcatg
ttttcctctgctaattctataaatatagggagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagacaaaaaagtaggggaaggagaaagtataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtggaaaaattaatttgtgcatctaatgagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatccagtaacttggaaagatttttgtatgaaataagtggaaaagattcatgc
cttataaaaaatctcatgacagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcagatgaagatgatacacttaaa
gctattgcaaaagtctatgaaagttctaattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaatagaacagaagataatagggttactattatagca
tccactgcaagtccattcaaatttcctaaaagtataaatgaagtgttaaatataggacat
aagaatgcctcagattttgaacttattaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaagagaaatttgtcataagggcacttgtaaaaag
gatgaaatgaagaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system