KEGG   Clostridium botulinum A2: CLM_2209Help
Entry
CLM_2209          CDS       T00883                                 

Gene name
pfkB
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cby  Clostridium botulinum A2
Pathway
cby00010  Glycolysis / Gluconeogenesis
cby00030  Pentose phosphate pathway
cby00051  Fructose and mannose metabolism
cby00052  Galactose metabolism
cby00680  Methane metabolism
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01120  Microbial metabolism in diverse environments
cby01130  Biosynthesis of antibiotics
cby01200  Carbon metabolism
cby01230  Biosynthesis of amino acids
Module
cby_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_2209 (pfkB)
   00030 Pentose phosphate pathway
    CLM_2209 (pfkB)
   00051 Fructose and mannose metabolism
    CLM_2209 (pfkB)
   00052 Galactose metabolism
    CLM_2209 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CLM_2209 (pfkB)
Enzymes [BR:cby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLM_2209 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACO83742
UniProt: C1FPP6
Position
complement(2276657..2277580)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEVFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELNKKNILTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRETQKDLLK
YLSSNLKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKDEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGDKIYYCNAP
KIKLLSSACAGDSALAAFLSEWFYEANIEKALKKASATGANVAESSALGTFGKVSEYIKK
IHVKEVV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgttcttccagtagtaat
gaagtttttaaggtaaatagaactaataatttatcttattcgcctaatggaaaaggagta
aacgtatcgctagttttaaatcattattctatagaaagcaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattaaataagaaaaatatacttacagaagcc
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggaaacccaaaaggatttattaaaa
tacttatcatcaaatttaaaaaaaggtgattatttaataataagtggaagtcttccccaa
agtattcaagaggattactacaatgaaattttagatatatgtatggagaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataaacctttatta
attaaacctaatgatgaagaagttgaggcaatatttggtctaagtttaaaagatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctgacc
ttaggggagaaaggaatgtatttttacaatggagacaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggactcggccttagcagcatttttaagt
gaatggttctatgaagctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttggtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtagtgtaa

DBGET integrated database retrieval system