KEGG   Clostridium botulinum A2: CLM_3150Help
Entry
CLM_3150          CDS       T00883                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cby  Clostridium botulinum A2
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cby00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3160658..3162154)
Genome map
AA seq 498 aa AA seqDB search
MEKYIMSLDQGTTSSRCIIFNKKGEVVSVAQKEFTQIYPKAGWVEHDPLEIWGKQAGVAG
EALNIARISPEQIAGIGITNQRETTVVWNKRTGMPIYNAIVWQCRRTAGYCDELREKGLD
KTIKEKTGLMLDAYFSATKIKWILDNVEGARELAEKGDLLFGNIDTWLIWNMTKGKIHVT
DYTNASRTMLFNIHELKWDEELLEILDIPKSMLPEVKPSSCVYGETDEILFGVSIPISGD
AGDQQAALFGQTCFNAGMAKNTYGTGCFLLMNTGEKAVDSKNGLLTTIAVGIDGKVEYAL
EGSIFIGGAVIQWLRDELRMVKTAQETEKYATEVEDNNGVYLVPAFVGIGAPYWDSYARG
TILGLTRGAKKEHIIRAALESMAYQTHDVLKAMEEDSGIELKALKVDGGACQNNFLMQFQ
SDILGVEVDRPEVVETTALGAAYLAGLAVGYWKDRNEISQNWAISRSFAPAMEDEKKEKL
IKGWHKAVTKAMDWEDKE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatataatgtctttagatcaaggaactactagttcaagatgtataatattt
aataaaaaaggtgaagtagtaagtgttgcccaaaaggaatttacacaaatatatcctaaa
gcaggatgggtagagcatgatccactagaaatatggggaaaacaagcaggggtagcagga
gaagcattaaatatagctagaatttctccagaacaaatagcaggtataggtataactaat
caaagggaaaccacagtagtttggaataaaagaacaggaatgccaatatataatgctata
gtatggcaatgtagaagaacagctggttattgtgatgaattaagagaaaaaggtttagat
aaaactataaaagaaaaaacaggtttaatgctagatgcctatttttcagcaacaaaaata
aaatggatattagataatgtagagggagctagggaattagcagaaaaaggtgatttgtta
ttcggaaatatagatacttggttaatctggaatatgacaaaagggaaaattcatgtaaca
gattatactaatgcttcaagaactatgttatttaacatacatgaattaaaatgggatgag
gaattattagaaatacttgatattcctaaatctatgcttccggaagtaaaaccatctagt
tgtgtatatggtgaaacagatgaaatattgttcggggtatcaattccaatatccggagat
gcaggagatcaacaagcagcattgtttggacaaacttgctttaatgcgggtatggctaaa
aatacttatggtacaggttgtttcttgttgatgaatacaggagaaaaagcagtagattct
aaaaatggattattaactactatagctgtgggtatagatggaaaagttgaatatgcttta
gaaggaagtatatttataggtggagcagtaattcaatggttaagagatgaacttagaatg
gtaaaaactgctcaagaaacagaaaaatatgctacagaagtagaagataataatggagtt
taccttgtgccagcttttgttggaataggtgcaccatactgggattcttatgcaagagga
actatattaggacttacaagaggagctaaaaaagaacatataataagagccgcattagaa
tctatggcataccaaactcatgatgttttaaaggctatggaagaggactcaggtatagaa
ctaaaagcattaaaagtagatgggggagcttgtcaaaataatttcttaatgcaatttcaa
tctgatatattaggtgtagaagtagatagaccagaagtagtagagactacagcattagga
gcagcttatcttgcaggacttgcagtaggttattggaaggatagaaatgaaatatcacaa
aactgggcaatttcaagaagctttgctccagcgatggaagatgaaaagaaagaaaaactt
ataaaaggatggcataaggcagtaacaaaagcaatggattgggaagataaagaataa

DBGET integrated database retrieval system