KEGG   Clostridium botulinum A2: CLM_3173Help
Entry
CLM_3173          CDS       T00883                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cby  Clostridium botulinum A2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cby00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cby00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cby00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3185530..3186447)
Genome map
AA seq 305 aa AA seqDB search
MNRLLKTIIENNRKWISEGKVASYIPELSKMDKNLLGISVCTLGGEEYWEGDAEVKFTIQ
SISKIVTLMLAIIDNGEDYVFSKVGMEPTETAFNSIVNLEAKESHKPINPMINAGAIVVA
SMVAGKDSDEKFDRILKFTRKISGNNNIDINLNVYKSEKETGHRNRALAYFMKSTGALKG
NVEEILDVYFKQCSIEITCKDLARIGVMLANDGVSPYTGDRIVPRHVARIVKTIMVTCGM
YDASGNFAVHIGIPAKSGVGGGIVACAPRRMGIGVLGTALDEKGNSIAGTKILEELSKQL
DLSIF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactgcttaagacgattatagaaaataatagaaaatggataagtgaaggaaag
gtggcctcatatattcctgaactttctaaaatggataaaaatttactaggtatttctgta
tgtaccctaggaggagaagaatattgggaaggcgatgctgaagttaagtttactattcaa
agtatatcaaaaatagtaactttaatgctagccataatagacaatggagaggattatgtt
ttttcaaaggtaggaatggaacctacagaaactgcttttaattctatagtaaatttagaa
gcaaaagaatctcataagcctataaatccaatgataaatgctggtgccatagtggtggct
tctatggtagctggaaaagattcagatgaaaagtttgatagaatcttaaagtttactaga
aaaataagtggtaataataatattgatataaatctaaatgtatataaatccgaaaaagaa
acaggacatagaaacagagctcttgcttattttatgaaaagcacaggagccctcaaggga
aatgtagaagagattttagatgtgtattttaaacaatgttctatagaaattacttgtaaa
gatttagctagaataggagttatgttagctaatgatggggtatctccttatactggtgat
agaatagttccaaggcatgtggctagaattgtaaaaactataatggtaacctgtggtatg
tatgatgcttcaggaaattttgcagtacatatcggaatacctgctaaaagtggagttgga
ggaggtatagttgcctgtgctccgagaagaatgggtataggggttttaggcacagcttta
gatgaaaagggtaatagtatagctggaactaagatattagaagagctttcaaagcaatta
gatttaagtattttttaa

DBGET integrated database retrieval system