KEGG   Clostridium botulinum A2: CLM_3835Help
Entry
CLM_3835          CDS       T00883                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cby  Clostridium botulinum A2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLM_3835 (pfkA)
   01230 Biosynthesis of amino acids
    CLM_3835 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_3835 (pfkA)
   00030 Pentose phosphate pathway
    CLM_3835 (pfkA)
   00051 Fructose and mannose metabolism
    CLM_3835 (pfkA)
   00052 Galactose metabolism
    CLM_3835 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CLM_3835 (pfkA)
Enzymes [BR:cby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLM_3835 (pfkA)
Protein phosphatases and associated proteins [BR:cby01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLM_3835 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3874139..3875098)
Genome map
AA seq 319 aa AA seqDB search
MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDI
IQRGGTILRTARCEEFRTEQGREKAAKILKAFGIDGLVVIGGDGSFHGAQLLSKLGINTV
GLPGTIDNDLAYTDYTIGFDTSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYT
GVAGGAESIIIPEKEYNADKLCKQILQGKLKGKMHNLVLLAEGVGGANELAKYIEEVTGI
ETRSTILGHIQRGGSPTCMDRILASRMAYKAVELLISGKSSRVVGIKNGKIIDMDIDEAL
AVERSFDQELYDIATILSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatagctgtattaacaagtggtggagatgcaccaggaatgaatgctgctatc
agagcagtagttagaacaggtttagaaaaaggtttaaaagtaatgggaattcaaagagga
tataacggacttataaatggagaaatatttgaaatggatactcatagcgtatctgatata
atacaaagaggcggaactatattaagaacagctcgttgtgaagagtttagaacagagcag
ggaagagaaaaagctgctaaaatattaaaagcctttggtattgatggattagttgtaatt
ggtggagacggttcttttcatggggcccaattattatctaagttaggaataaatactgtt
ggactaccaggtactatagataatgatttagcttatacagactatacaattggctttgat
acatctataaatacagttttagatgctataaataagcttagagatacatccacttctcat
gaaagagtaagtgtagtagaagttatgggaagaaattgtggagatatagcattatataca
ggagtagctggtggagcagaaagtattataataccagaaaaagagtataatgcagataaa
ttatgcaaacaaatactacaaggaaaattaaaagggaaaatgcataacttagttttatta
gcagaaggtgttggaggagctaatgaactagcaaaatatatagaagaggttacagggata
gaaacaagatctacaatattaggacatatacaaaggggtggaagtccaacttgtatggat
agaatattagcttcaagaatggcttataaggcagtagaattattgattagtggtaaatct
tcaagagtagttggtataaaaaatggaaaaataattgatatggatatagatgaagcttta
gcagtagaaagaagttttgaccaagaattatatgacatagcaactattttatccaaataa

DBGET integrated database retrieval system