KEGG   Chlamydophila caviae: CCA00120Help
Entry
CCA00120          CDS       T00125                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cca  Chlamydophila caviae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CCA00120 (ruvA)
Enzymes [BR:cca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CCA00120 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124286..124909
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGILTYMSSGTLVIECQGLGFNIFAPDRWLIELSGQLHREVVVYTYTVVRETEHV
LYGFSSRRERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARAEDVRAIASVPGIGKK
TAEKLMVDLKQKLPDLLPLDSKAIASWESVKPSCMDEGIQALAALGYSKPSAERMIAEAM
SELPENASLAEILPIALKKNLQGLNKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggaattcttacttatatgagttctggaactcttgtgatcgaa
tgtcagggattaggattcaatatttttgctcccgatcgatggttgattgagctgtcaggt
caattacatcgtgaagttgttgtgtatacctatacggttgttcgtgaaacagaacatgtg
ttgtatggatttagttctcgaagagaacgcgaatgtttccgtatgttaatttcattttct
ggagtaggccctaagacaggcctagcaatattaaatacattttctcttagcaaattatgt
tctatagcacgtgctgaggatgtcagagctatagcttctgttcctggtatagggaaaaaa
acagcagaaaagcttatggtagacctcaagcaaaagcttccagatttacttcctttagat
tctaaagcaattgcttcttgggaatccgtaaaaccttcgtgtatggatgagggtatacaa
gcattagctgcattaggatattctaaaccttcagcagagagaatgattgctgaagctatg
agtgaacttccagagaatgcatcgttagcagaaattcttcctattgctttaaaaaagaac
ttacaaggtttgaacaagagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system