KEGG   Chlamydophila caviae: CCA00218Help
Entry
CCA00218          CDS       T00125                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cca  Chlamydophila caviae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCA00218
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCA00218
  Amino acid metabolism
   00310 Lysine degradation
    CCA00218
Enzymes [BR:cca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CCA00218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233750..234922
Genome map
AA seq 390 aa AA seqDB search
MFEFRFPKIGETGSGGFVVRWLKQVGENVAKDEPIIEVSTDKIATELASPKAGKLIRCLV
SEGDEVASGEILAEIAIESGMQEEVLEEASSKTSCSHSQDCGNSPGWFSPAVLSLAHREG
VSIQQLQQISGTGNEGRVTRKDLENYISEMRAPSSPKTTNANENRIPMSPLRRAIASSLS
KSSDEVPHASLIVDIDVTDLMNLISEEKDRFFATHGVKLTITSFIIQCLAKALEQFPLLN
GSLDGDTIVVKKSINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKTLADVSTRARSNKLD
PSETQDGSITVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMVYVT
LTFDHRVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttcgatttccgaaaataggggagacgggttccggagggtttgtagtccgt
tggctcaagcaagtaggtgagaatgttgcaaaagacgaacctataattgaagtgtcaaca
gacaagattgctactgaattagcatctcctaaagcagggaaattgattcgttgtctcgta
agtgaaggtgatgaagtcgcctctggagaaattttagccgaaattgctatagaatcgggt
atgcaagaagaagttttagaagaagcctcttctaagacttcttgttctcattctcaagat
tgtggaaattccccaggatggttttcaccagcagttcttagtttagcgcatcgcgaaggt
gttagcatccaacagctccaacaaatttctggaacaggaaatgaggggcgtgtgacgcgt
aaagatttagaaaattatatttctgaaatgcgtgcgccttcgtctccaaaaacaacaaat
gcgaatgaaaatcgcattcctatgtctccactacgtagagctatagcttcttcattatct
aaatcttcagatgaagtgcctcacgcgtctcttattgtagatattgatgtcacagatttg
atgaacttaatctctgaggagaaagacagattctttgcaacacatggtgtgaaactgacg
attacgagtttcattattcaatgtttagcaaaggccttggagcaattcccgttattaaat
ggatctttagacggggatacaatcgttgtgaagaaatccataaatgtgggagttgctgtt
aatttgaataaagagggtgttgttgtccctgttattcacaattgtcaagaccgtggttta
gtcagcattgcaaaaactctcgcggatgtatctacaagagctcgatccaataagcttgac
ccttcagaaactcaagatggtagcatcacagtgactaatttcggtatgacgggagcttta
attggtatgccgataattcgttatcccgaagtggctattttaggaataggaacaatacaa
aaacgtgttgttgttcgtgatgatgattctctagctatccgaaaaatggtctatgttacg
ctaacatttgaccatagagtgcttgacggcatttacggtagtgaatttttaacctcattg
aaaaatcggttagagtctgttacgatgagctaa

DBGET integrated database retrieval system