KEGG   Chlamydophila caviae: CCA00308Help
Entry
CCA00308          CDS       T00125                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cca  Chlamydophila caviae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCA00308 (tpiA)
   01230 Biosynthesis of amino acids
    CCA00308 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCA00308 (tpiA)
   00051 Fructose and mannose metabolism
    CCA00308 (tpiA)
   00562 Inositol phosphate metabolism
    CCA00308 (tpiA)
Enzymes [BR:cca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CCA00308 (tpiA)
Exosome [BR:cca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CCA00308 (tpiA)
  Exosomal proteins of bladder cancer cells
   CCA00308 (tpiA)
  Exosomal proteins of melanoma cells
   CCA00308 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359233..359997
Genome map
AA seq 254 aa AA seqDB search
MERKSYVFGNWKMHKTAKEAKDFLSIFCPFVKEISPASLVGIAPAFTTLSACCESIKEMD
SSIWLGAQNVHQDSSGAFTGEVSLPMLQEFHVNFVLLGHSECRHIFHEEDATIALKVGAA
ARSGVVPVLCIGETLEARENGTTKEVLSNQLMLGLAQLPETAPVIIAYEPVWAIGTGKVA
STADVQEVHAFCREVLSRIFSKEKSEIISILYGGSVKADNAEGFARCPDVDGLLVGGASL
DPQGFANVLRNFNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcaagagttatgtttttggtaattggaaaatgcataagacagctaaggaagct
aaagactttttatcgattttttgccctttcgttaaagaaatttctcctgcatccctagtg
ggtatagctccagcatttacaacattaagtgcttgctgcgaatccataaaagagatggac
tcttctatttggttaggagcgcaaaatgtccatcaggactcttctggagccttcacaggg
gaagtgtccttgcccatgcttcaagaatttcatgtaaattttgttcttctagggcattca
gaatgtcggcatatctttcatgaagaagacgctaccatagctcttaaagtgggggctgca
gctcgttcgggagtggttccagttttatgtattggcgagactttagaagccagagaaaat
ggtacgactaaggaggttttgtctaaccaattgatgttgggactggctcagcttcccgaa
acagcccccgtgattattgcctacgagcctgtatgggcaatcggtacgggaaaagttgct
tcaaccgcagatgtgcaagaagttcacgctttttgtcgcgaggttctctctcgtatattc
tctaaagaaaaatctgagataatttctattctctacggcggatctgtaaaagctgacaac
gcagaaggatttgctcgctgccccgatgtggatggtttattggtaggaggagcctcttta
gatcctcaaggttttgccaatgttttaagaaattttaatctttaa

DBGET integrated database retrieval system