KEGG   Chlamydophila caviae: CCA00421Help
Entry
CCA00421          CDS       T00125                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cca  Chlamydophila caviae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCA00421 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCA00421 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CCA00421 (sucB)
Enzymes [BR:cca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CCA00421 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473761..474858
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVTSESLVQENQGIMEIESDKVNQLIYAPTSGRIVWSV
SEGDVVAVGGGVAKIYDANEAVPESAIENTSSSESVDAEIICFPRSKAHEPPAEGKTFVP
LRDKIQNAPQPAGSKNEVREHMSSIRKTISRRLVSALHESAMLTTFNEIHMTPLMKLRKE
KQESFSSRYNVKLGLMSFFIKAVIEGLKAYPRVNAYIEGDEIVYRQYYDISIAVGTERGL
VVPVIRDCDKLSSGDIEVKLADLAGRARDGQISIPELEGGSFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVLDNTIVIADMMYVAFSYDHRMIDGKEAVGFLIKIKDAIEQPE
TLLDL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaagtacgcattccaaatgtcgctgaatccataagtgaagtgaccatagct
tcccttttggtaacttcagaaagtctggttcaggagaatcaaggcattatggagatcgaa
agtgacaaagtaaatcagcttatctatgctcctacatctggaaggattgtctggtcagtt
tctgaaggcgatgttgttgctgttggagggggtgttgctaaaatttatgatgctaatgaa
gctgtccctgaaagcgctatagagaacacttcttctagcgaatctgtagatgctgagatt
atctgcttcccaagatctaaagctcacgaacctcctgcggaggggaaaacttttgttccc
ttacgtgataaaattcaaaatgccccacagcctgcaggatctaaaaatgaggttcgtgag
catatgtcttctatacgcaaaacgatttctcgacgtttagtttctgctcttcatgaatcg
gcaatgttaaccacattcaacgagattcatatgacgcctcttatgaaactccgcaaggag
aaacaagagagcttttcttctcgttataatgtgaaattaggcttgatgtctttcttcata
aaagcagtgattgaagggttaaaagcttatcctcgtgtgaatgcctatattgaaggggat
gaaatcgtctaccgtcaatattatgatatttctattgctgtaggcacagagcgcggtctt
gttgttcccgtgattcgtgattgtgataaactctctagtggggacattgaagtaaaactt
gcagatttggcaggcagagctcgcgatggccagatttctattcctgagttagaaggagga
agcttcaccattactaatggtggtgtttacggctctttactttctacgcctattattaat
cctcctcaagtggggatattaggaatgcataaaatagaaaaacgtcccgtggttcttgat
aataccatcgttattgcagatatgatgtatgtagcttttagctatgatcatcgtatgatt
gatggtaaggaagctgtaggctttcttatcaaaatcaaagatgccatagaacaacctgaa
actcttttagatttatag

DBGET integrated database retrieval system